Transcription Factor
| Accessions: | ZBTB22 (HT-SELEX2 May2017) |
| Names: | ENSG00000206280, ZBTB22 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: BTB/POZ_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: BTB/POZ_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 113 |
| Pfam Domains: | 21-40 C2H2-type zinc finger 34-56 Zinc-finger double domain 46-68 Zinc finger, C2H2 type 46-68 C2H2-type zinc finger 60-83 Zinc-finger double domain 74-93 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 GSVGGVPGGTGSGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHH 60 61 LTEHMKTHTGLKPYECGVCAKKFMWRDSFMRHRGHCERRHRLGGVGAVPGPGT |
| Interface Residues: | 3, 5, 8, 28, 29, 30, 31, 32, 34, 35, 36, 56, 57, 58, 59, 60, 61, 62, 63, 64, 84, 85, 86, 87, 88, 90, 91, 93, 94, 100, 102 |
| 3D-footprint Homologues: | 7eyi_G, 1tf3_A, 6jnm_A, 7y3l_A, 7n5w_A, 1ubd_C, 6u9q_A, 4x9j_A, 2jpa_A, 1mey_C, 6e94_A, 5kl3_A, 2drp_D, 7ysf_A, 6wmi_A, 5ei9_F, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 1g2f_F, 8ssu_A, 1tf6_A, 2i13_A, 6blw_A, 5kkq_D, 8h9h_G, 4m9v_C, 2gli_A, 5v3j_F, 2lt7_A, 6a57_A, 3uk3_C, 8cuc_F, 2wbs_A, 5yel_A, 7txc_E, 1f2i_J, 5yj3_D, 5k5i_A, 6ml4_A, 8gn3_A, 1llm_D, 7y3m_I, 4noe_A |
| Binding Motifs: | ZBTB22_2 tkCACwAywrTaGTGmw ZBTB22_methyl_1 hKCACtAywrTaGTGMd |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.