Transcription Factor

Accessions: GLIS2_DBD (HumanTF 1.0), GLIS2 (HT-SELEX2 May2017)
Names: GLI-similar 2, GLIS2, GLIS2_HUMAN, Neuronal Krueppel-like protein, Zinc finger protein GLIS2, ENSG00000274636
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q9BZE0
Notes: Ensembl ID: ENSG00000126603; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Gene synthesis, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4
Length: 189
Pfam Domains: 73-95 Zinc-finger double domain
84-102 C2H2-type zinc finger
84-106 Zinc finger, C2H2 type
98-125 Zinc-finger double domain
112-136 Zinc finger, C2H2 type
112-136 C2H2-type zinc finger
142-166 Zinc finger, C2H2 type
142-166 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 PPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCAR 60
61 HGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCN 120
121 KRYSNSSDRFKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHGHFVSHEQQELLQL 180
181 RPPPKPPLP
Interface Residues: 29, 30, 32, 33, 36, 53, 54, 56, 60, 66, 67, 69, 70, 71, 72, 73, 76, 79, 94, 95, 96, 97, 98, 100, 101, 104, 124, 125, 126, 127, 128, 129, 130, 131, 132, 154, 155, 156, 157, 158, 159, 160, 161, 162
3D-footprint Homologues: 7w1m_H, 1tf6_A, 5yel_A, 7ysf_A, 3uk3_C, 8cuc_F, 1tf3_A, 5v3j_F, 1g2f_F, 4x9j_A, 2gli_A, 5kl3_A, 5ei9_F, 6ml4_A, 5k5i_A, 6e94_A, 8gn3_A, 1ubd_C, 2jpa_A, 7y3l_A, 6jnm_A, 8ssq_A, 6blw_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 1llm_D, 7n5w_A, 8h9h_G, 2lt7_A, 7y3m_I, 6a57_A, 5yj3_D, 2wbs_A, 7txc_E, 1f2i_J, 4m9v_C
Binding Motifs: GLIS2_DBD kACCCCCCrCramG
GLIS2_2 aCCCCCCrCrwhGc
GLIS2_methyl_1 ACCCCCyrCrdwGc
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.