Transcription Factor
| Accessions: | GLIS2_DBD (HumanTF 1.0), GLIS2 (HT-SELEX2 May2017) |
| Names: | GLI-similar 2, GLIS2, GLIS2_HUMAN, Neuronal Krueppel-like protein, Zinc finger protein GLIS2, ENSG00000274636 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q9BZE0 |
| Notes: | Ensembl ID: ENSG00000126603; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Gene synthesis, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4 |
| Length: | 189 |
| Pfam Domains: | 73-95 Zinc-finger double domain 84-106 Zinc finger, C2H2 type 84-102 C2H2-type zinc finger 98-125 Zinc-finger double domain 112-136 Zinc finger, C2H2 type 112-136 C2H2-type zinc finger 142-166 C2H2-type zinc finger 142-166 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 PPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCAR 60 61 HGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCN 120 121 KRYSNSSDRFKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHGHFVSHEQQELLQL 180 181 RPPPKPPLP |
| Interface Residues: | 29, 30, 32, 33, 36, 53, 54, 56, 60, 66, 67, 68, 69, 70, 71, 72, 73, 76, 79, 94, 95, 96, 97, 98, 100, 101, 104, 124, 125, 126, 127, 128, 129, 130, 131, 132, 154, 155, 156, 157, 158, 159, 160, 161, 162 |
| 3D-footprint Homologues: | 7w1m_H, 5yel_A, 1tf6_A, 2i13_A, 7ysf_A, 5v3j_F, 1tf3_A, 3uk3_C, 8cuc_F, 6ml4_A, 2gli_A, 4x9j_A, 1g2f_F, 5kl3_A, 6wmi_A, 5ei9_F, 7eyi_G, 8gn3_A, 6e94_A, 5k5i_A, 1ubd_C, 2jpa_A, 7y3l_A, 6jnm_A, 1mey_C, 7n5w_A, 6blw_A, 5kkq_D, 6u9q_A, 8h9h_G, 8ssq_A, 1llm_D, 5und_A, 2kmk_A, 8ssu_A, 2lt7_A, 7y3m_I, 6a57_A, 1f2i_J, 7txc_E, 2wbs_A, 5yj3_D, 4m9v_C |
| Binding Motifs: | GLIS2_DBD kACCCCCCrCramG GLIS2_2 aCCCCCCrCrwhGc GLIS2_methyl_1 ACCCCCyrCrdwGc |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.