Transcription Factor

Accessions: 1tf3_A (3D-footprint 20260701)
Names: S-TFIIIA/O-TFIIIA, TF3A_XENLA, TFIIIA, TRANSCRIPTION FACTOR IIIA
Organisms: Xenopus laevis
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03001
Length: 92
Pfam Domains: 4-28 Zinc finger, C2H2 type
4-28 C2H2-type zinc finger
21-47 Zinc-finger double domain
34-58 Zinc finger, C2H2 type
34-58 C2H2-type zinc finger
50-77 Zinc-finger double domain
64-89 C2H2-type zinc finger
64-89 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MKRYICSFADCGAAYNKNWKLQAHLSKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTG 60
61 EKNFTCDSDGCDLRFTTKANMKKHFNRFHNIK
Interface Residues: 15, 16, 17, 18, 19, 20, 22, 23, 24, 29, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 57, 75, 76, 77, 78, 79, 80, 81, 82, 83, 87
3D-footprint Homologues: 8gn3_A, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 3uk3_C, 5kkq_D, 4x9j_A, 2gli_A, 1f2i_J, 5kl3_A, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 7ysf_A, 1ubd_C, 6blw_A, 5k5i_A, 2kmk_A, 6u9q_A, 5yel_A, 8h9h_G, 4m9v_C, 2lt7_A, 6e94_A, 6a57_A, 7w1m_H, 8cuc_F, 7y3l_A, 5yj3_D, 2wbs_A, 7txc_E, 5v3j_F, 8ssq_A, 1llm_D, 2drp_D, 7y3m_I
Binding Motifs: 1tf3_A TGkATGGGAGAm
Binding Sites: 1tf3_E
1tf3_F
Publications: Foster M.P, Wuttke D.S, Radhakrishnan I, Case D.A, Gottesfeld J.M, Wright P.E. Domain packing and dynamics in the DNA complex of the N-terminal zinc fingers of TFIIIA. Nature structural biology 4:605-8 (1997). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.