Transcription Factor

Accessions: PTF1A (HT-SELEX2 May2017)
Names: ENSG00000168267, PTF1A
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 118
Pfam Domains: 29-79 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 RLRGLSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYE 60
61 KRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKV
Interface Residues: 29, 32, 33, 35, 36, 37, 39, 40, 65
3D-footprint Homologues: 7z5k_B, 2ypa_A, 8osb_B, 6od3_F, 7d8t_A, 8hov_A, 5i50_B, 1am9_A, 7rcu_E, 6g1l_A, 4h10_A, 8osl_P, 2ql2_D, 5eyo_A, 2ypa_B, 2ql2_A, 7ssa_L
Binding Motifs: PTF1A_2 gyGTCAGCTGTT
PTF1A_methyl_1 ryGTCAGCTGtt
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.