Transcription Factor

Accessions: 1dsz_A (3D-footprint 20231221)
Names: Nuclear receptor subfamily 1 group B member 1, RAR-alpha, RARA_HUMAN, RETINOIC ACID RECEPTOR ALPHA
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P10276
Length: 75
Pfam Domains: 2-69 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 PCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQ 60
61 KCFEVGMSKESVRND
Interface Residues: 10, 11, 13, 14, 20, 21, 22, 23, 24, 26, 27, 28, 31, 33, 37, 52, 56, 58, 60
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 1a6y_A, 1lo1_A, 3g9m_B, 4oln_B, 2a66_A, 8hbm_B, 5krb_G, 2nll_B, 1lat_A, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xv6_B, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 2han_B, 1kb2_B, 4yhx_A, 4tnt_B, 5cbz_E, 4hn5_B, 5e69_A, 3g6t_A, 1r4i_A, 5emc_A, 7prw_B, 5cbx_B
Binding Motifs: 1dsz_A tGaCC
1dsz_AB tGACCnnTGaCC
Binding Sites: 1dsz_C
1dsz_D
Publications: Rastinejad F., Wagner T., Zhao Q., Khorasanizadeh S. Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1.. EMBO J. 19:1045-1054 (2000). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.