Transcription Factor
| Accessions: | 1dsz_A (3D-footprint 20250804) |
| Names: | Nuclear receptor subfamily 1 group B member 1, RAR-alpha, RARA_HUMAN, RETINOIC ACID RECEPTOR ALPHA |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P10276 |
| Length: | 75 |
| Pfam Domains: | 2-69 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 PCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQ 60 61 KCFEVGMSKESVRND |
| Interface Residues: | 10, 11, 13, 14, 20, 21, 22, 23, 24, 26, 27, 28, 31, 33, 37, 52, 56, 58, 60 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2ff0_A, 1dsz_A, 8hbm_B, 4umm_E, 3cbb_A, 7xv6_B, 4iqr_B, 2han_A, 1hcq_E, 7xvn_C, 2han_B, 1kb2_B, 2a66_A, 8cef_H, 5krb_G, 2nll_B, 1lat_A, 4yhx_A, 4hn5_B, 5e69_A, 8rm6_A, 3g6t_A, 1r4i_A, 5emc_A, 7prw_B, 5cbx_B, 4tnt_B, 5cbz_E |
| Binding Motifs: | 1dsz_A tGaCC 1dsz_AB tGACCnnTGaCC |
| Binding Sites: | 1dsz_C 1dsz_D |
| Publications: | Rastinejad F., Wagner T., Zhao Q., Khorasanizadeh S. Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1.. EMBO J. 19:1045-1054 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.