Transcription Factor

Accessions: T049433_1.02 (CISBP 1.02)
Names: T049433_1.02;, Zic2
Organisms: Mus musculus
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 284
Pfam Domains: 27-45 C2H2-type zinc finger
56-81 Zinc finger, C2H2 type
60-81 C2H2-type zinc finger
74-99 Zinc-finger double domain
87-111 Zinc finger, C2H2 type
87-111 C2H2-type zinc finger
103-130 Zinc-finger double domain
117-141 Zinc finger, C2H2 type
117-141 C2H2-type zinc finger
135-158 Zinc-finger double domain
147-169 Zinc finger, C2H2 type
147-169 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHVCFWEE 60
61 CPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCE 120
121 FEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQGSESSP 180
181 AASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGAGSGSSGSG 240
241 GGSAAGSGGGGGGAGGGGGGSSGGGSGTTGGHSGLSSNFNEWYV
Interface Residues: 39, 69, 70, 71, 72, 73, 75, 76, 80, 87, 99, 100, 101, 102, 103, 105, 106, 107, 108, 109, 111, 112, 115, 129, 130, 131, 132, 133, 134, 135, 136, 137, 140, 157, 158, 159, 160, 161, 162, 163, 164, 165
3D-footprint Homologues: 1ubd_C, 7n5w_A, 1tf3_A, 7w1m_H, 8cuc_F, 6ml4_A, 8gn3_A, 5kkq_D, 5ei9_F, 2gli_A, 8ssq_A, 1tf6_A, 8ssu_A, 7eyi_G, 6e94_A, 7ysf_A, 6wmi_A, 5k5i_A, 2i13_A, 5und_A, 2lt7_A, 2kmk_A, 3uk3_C, 6jnm_A, 7y3l_A, 4x9j_A, 1mey_C, 6blw_A, 6u9q_A, 5yel_A, 5kl3_A, 1g2f_F, 1llm_D, 2v6e_B, 8h9h_G, 7y3m_I, 6a57_A, 2jpa_A, 5v3j_F, 2wbs_A, 2drp_D, 1f2i_J, 7txc_E, 5yj3_D, 5k5l_F, 4m9v_C
Binding Motifs: M0439_1.02 crcagsrgGk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.