Transcription Factor
Accessions: | ATHB1 (Athamap 20091028), Q02283 (JASPAR 2024), T14465 (AthalianaCistrome v4_May2016) |
Names: | ATHB1, HAT5_ARATH, HD-ZIP protein 5, HD-ZIP protein ATHB-1, Homeobox-leucine zipper protein HAT5, Homeodomain transcription factor ATHB-1, Homeodomain-leucine zipper protein HAT5, AT3G01470, HAT5, T14465; |
Organisms: | Arabidopsis thaliana |
Libraries: | Athamap 20091028 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:Homeobox |
Length: | 272 |
Pfam Domains: | 68-121 Homeobox domain 123-167 Homeobox associated leucine zipper |
Sequence: (in bold interface residues) | 1 MESNSFFFDPSASHGNSMFFLGNLNPVVQGGGARSMMNMEETSKRRPFFSSPEDLYDDDF 60 61 YDDQLPEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARW 120 121 KTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSLTEKLQGKQETANEPPGQVPE 180 181 PNQLDPVYINAAAIKTEDRLSSGSVGSAVLDDDAPQLLDSCDSYFPSIVPIQDNSNASDH 240 241 DNDRSCFADVFVPTTSPSHDHHGESLAFWGWP |
Interface Residues: | 64, 68, 69, 70, 71, 107, 108, 110, 111, 114, 115, 118, 119, 122, 262, 264 |
3D-footprint Homologues: | 3a01_E, 1zq3_P, 1b72_A, 5zfz_A, 7q3o_C, 1puf_A, 6a8r_A, 5jlw_D, 4cyc_A, 2r5y_A, 1puf_B, 6es3_K, 2ld5_A, 3d1n_M, 1nk2_P, 1au7_A, 1ig7_A, 6ryd_F, 7xrc_C, 1e3o_C, 1le8_A, 7psx_B, 4qtr_D, 5hod_A, 3lnq_A, 1o4x_A, 1du0_A, 5zjt_E, 4xrm_B, 3cmy_A, 2h1k_B, 1jgg_B, 3rkq_B, 2lkx_A, 4xrs_G, 2hdd_A, 6wig_A, 8g87_X, 1fjl_B, 5flv_I, 3l1p_A, 2hos_A, 6m3d_C, 5itu_A |
Binding Motifs: | ATHB1 cAATTATTG MA0008.1 cAATTATT MA0008.2 ytcAATTATTGs M0441 wwcAATAATTgaww M0442 wyAATAATTrw MA0008.3 wwwCAATWATTGaww MA0008.4 CAATWATTG |
Binding Sites: | MA0008.4.19 MA0008.1.1 MA0008.1.10 MA0008.1.11 MA0008.1.12 MA0008.1.13 MA0008.1.14 MA0008.1.15 MA0008.1.16 MA0008.1.17 MA0008.1.18 MA0008.1.19 MA0008.1.2 MA0008.1.20 MA0008.1.3 MA0008.1.4 MA0008.1.5 MA0008.1.6 MA0008.1.7 MA0008.1.8 MA0008.1.9 MA0008.3.1 MA0008.3.10 MA0008.3.11 MA0008.3.12 MA0008.3.13 MA0008.3.14 MA0008.3.15 MA0008.3.16 MA0008.3.17 MA0008.3.18 MA0008.3.19 MA0008.3.2 MA0008.3.20 MA0008.3.3 MA0008.3.4 MA0008.3.5 MA0008.3.6 MA0008.3.7 MA0008.3.8 MA0008.3.9 MA0008.4.1 / MA0008.4.14 MA0008.4.10 / MA0008.4.13 / MA0008.4.16 / MA0008.4.18 / MA0008.4.5 / MA0008.4.7 / MA0008.4.8 MA0008.4.11 / MA0008.4.12 / MA0008.4.15 / MA0008.4.17 / MA0008.4.4 / MA0008.4.6 / MA0008.4.9 MA0008.4.2 MA0008.4.20 / MA0008.4.3 |
Publications: | Sessa G., Morelli G., Ruberti I. The Athb-1 and -2 HD-Zip domains homodimerize forming complexes of different DNA binding specificities. EMBO J. 12:3507-3517 (1993). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.