Transcription Factor

						

			
Accessions: 3cro_R (3D-footprint 20231221)

			
Names: 434 CRO, Antirepressor, RCRO_BP434, Regulatory protein cro
Organisms: Phage 434
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03036
Length: 64
Pfam Domains:      4-58 Helix-turn-helix domain
     6-63 Helix-turn-helix domain
     8-61 Helix-turn-helix
Sequence: 
(in bold interface residues)		   1 MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVW   60
  61 LQYG
Interface Residues: 19, 20, 29, 30, 31, 32, 34, 35, 38, 40, 41, 43, 45
3D-footprint Homologues: 3cro_R, 1per_L, 4pu3_C, 4z5h_A, 3dnv_B, 5k98_B, 3zkc_A
Binding Motifs: 3cro_LR TAMwAnnnnnnkTGTA
3cro_R tAcA
Binding Sites: 3cro_A
3cro_B
			
Publications: Mondragón A, Harrison S.C. The phage 434 Cro/OR1 complex at 2.5 A resolution. Journal of molecular biology 219:321-34 (1991). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.