Transcription Factor
| Accessions: | Q9FTA2 (JASPAR 2024), T21230 (AthalianaCistrome v4_May2016) |
| Names: | Protein CCA1 HIKING EXPEDITION, Protein CHE, TCP21_ARATH, Transcription factor TCP21, At5g08330, T21230; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1, AthalianaCistrome v4_May2016 2 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:TCP |
| Length: | 239 |
| Pfam Domains: | 25-192 TCP family transcription factor |
| Sequence: (in bold interface residues) | 1 MADNDGAVSNGIIVEQTSNKGPLNAVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTR 60 61 ELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTASLSTSSPFTLGKRVVRAEEGES 120 121 GGGGGGGLTVGHTMGTSLMGGGGSGGFWAVPARPDFGQVWSFATGAPPEMVFAQQQQPAT 180 181 LFVRHQQQQQASAAAAAAMGEASAARVGNYLPGHHLNLLASLSGGANGSGRREDDHEPR |
| Interface Residues: | 33, 34, 35, 44, 46 |
| 3D-footprint Homologues: | 7vp3_D, 7vp2_B |
| Binding Motifs: | M0747 / MA1287.1 wGTGGGmCCCAchw M0757 wGTGGGmCCcAy MA1287.2 GTGGGmCCCAc |
| Binding Sites: | MA1287.1.1 MA1287.1.10 / MA1287.1.12 / MA1287.1.5 MA1287.1.11 / MA1287.1.6 MA1287.1.13 / MA1287.1.7 MA1287.1.14 MA1287.1.15 MA1287.1.16 MA1287.1.17 MA1287.1.18 MA1287.1.19 MA1287.1.2 MA1287.1.20 MA1287.1.3 MA1287.1.4 MA1287.1.8 MA1287.1.9 MA1287.2.1 MA1287.2.10 MA1287.2.11 MA1287.2.12 MA1287.2.13 MA1287.2.14 MA1287.2.15 MA1287.2.16 MA1287.2.17 MA1287.2.18 MA1287.2.19 MA1287.2.2 MA1287.2.20 MA1287.2.3 MA1287.2.4 MA1287.2.5 MA1287.2.6 MA1287.2.7 MA1287.2.8 MA1287.2.9 |
| Publications: | Viola I. L., Uberti Manassero N. G., Ripoll R., Gonzalez D. H. The Arabidopsis class I TCP transcription factor AtTCP11 is a developmental regulator with distinct DNA binding properties due to the presence of threonine at position 15 of the TCP domain.. Biochem. J. 435:143 (2011). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.