Transcription Factor
| Accessions: | Q9FFS3 (JASPAR 2024), T24281 (AthalianaCistrome v4_May2016) |
| Names: | Probable WRKY transcription factor 24, WRK24_ARATH, WRKY DNA-binding protein 24, AT5G41570, T24281;, WRKY24 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1, AthalianaCistrome v4_May2016 2 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:WRKY |
| Length: | 179 |
| Pfam Domains: | 97-155 WRKY DNA -binding domain |
| Sequence: (in bold interface residues) | 1 MDREDINPMLSRLDVENNNTFSSFVDKTLMMMPPSTFSGEVEPSSSSSWYPESFHVHAPP 60 61 LPPENDQIGEKGKELKEKRSRKVPRIAFHTRSDDDVLDDGYRWRKYGQKSVKHNAHPRSY 120 121 YRCTYHTCNVKKQVQRLAKDPNVVVTTYEGVHNHPCEKLMETLNPLLRQLQFLSSFSNL |
| Interface Residues: | 104, 105, 106, 108, 109, 120 |
| 3D-footprint Homologues: | 6j4g_B, 6ir8_A, 6j4e_B, 6j4f_F, 7z0u_A |
| Binding Motifs: | M0811 / MA1315.1 kCGTTGACTTTttt M0803 dkCGTTGACTTTt MA1315.2 CGTTGACTTTt |
| Binding Sites: | MA1315.1.1 / MA1315.1.3 MA1315.1.10 MA1315.1.11 MA1315.1.12 MA1315.1.13 MA1315.1.14 MA1315.1.15 MA1315.1.16 MA1315.1.17 MA1315.1.18 MA1315.1.19 MA1315.1.2 MA1315.1.20 MA1315.1.4 MA1315.1.5 MA1315.1.6 MA1315.1.7 MA1315.1.8 MA1315.1.9 MA1315.2.20 MA1315.2.16 MA1315.2.6 MA1315.2.5 MA1315.2.2 MA1315.2.4 MA1315.2.14 MA1315.2.1 / MA1315.2.3 MA1315.2.10 MA1315.2.11 MA1315.2.12 MA1315.2.13 MA1315.2.15 MA1315.2.17 MA1315.2.18 MA1315.2.19 MA1315.2.7 MA1315.2.8 MA1315.2.9 |
| Publications: | Yu D, Chen C, Chen Z. 2001. Evidence for an important role of WRKY DNA binding proteins in the regulation of NPR1 gene expression. Plant Cell. 13:1527-40. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.