Transcription Factor
| Accessions: | CG7368 (FlyZincFinger 1.0 ) |
| Names: | CG7368 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 140 |
| Pfam Domains: | 11-33 Zinc finger, C2H2 type 39-62 C2H2-type zinc finger 39-61 Zinc finger, C2H2 type 39-61 Zinc-finger of C2H2 type 53-78 Zinc-finger double domain 67-87 C2H2-type zinc finger 67-89 Zinc finger, C2H2 type 82-105 Zinc-finger double domain 95-117 C2H2-type zinc finger 95-117 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 LGTALDGSPLYMCPECHVAYPEPELLEVHLVGHNLEKRYVCDICQASLKRKDHLTRHKQS 60 61 HNPERPYICTVCLKAFKRKEQLSLHFVIHSGEKRHQCGECGKGFYRKDHLRKHTRSHIAR 120 121 RVKAELNSHVRRENGTSMLQ |
| Interface Residues: | 21, 22, 23, 24, 25, 27, 28, 30, 31, 34, 39, 48, 49, 50, 51, 52, 53, 55, 56, 60, 77, 78, 79, 80, 81, 82, 83, 84, 85, 88, 105, 106, 107, 108, 109, 110, 111, 112, 113 |
| 3D-footprint Homologues: | 5kkq_D, 5ei9_F, 5k5l_F, 1tf6_A, 6ml4_A, 2i13_A, 7eyi_G, 6e94_A, 7ysf_A, 6wmi_A, 2jpa_A, 7w1m_H, 2kmk_A, 1tf3_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 6u9q_A, 5yel_A, 1mey_C, 5kl3_A, 5k5i_A, 8ssq_A, 5und_A, 2gli_A, 1g2f_F, 5v3j_F, 4x9j_A, 6blw_A, 2wbs_A, 8h9h_G, 2lt7_A, 7y3m_I, 6a57_A, 1ubd_C, 3uk3_C, 7txc_E, 2drp_D, 1f2i_J, 8gn3_A, 1llm_D, 4m9v_C, 5yj3_D |
| Binding Motifs: | CG7368_SANGER_5_FBgn0036179 KdGGrGkGGGGGGGGWwwvK CG7368_SOLEXA_2.5_FBgn0036179 kdGkGGGdGGGGGrr |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.