Transcription Factor

Accessions: 4jcx_B (3D-footprint 20241219)
Names: Csp231I C protein, Q32WH4_9ENTR
Organisms: Citrobacter sp. RFL231
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q32WH4
Length: 95
Pfam Domains: 4-69 Helix-turn-helix domain
4-61 Helix-turn-helix domain
6-64 Helix-turn-helix
Sequence:
(in bold interface residues)
1 MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIP 60
61 VSYLYTPEDDLAQIILTWNELNEQERKRINFYIRK
Interface Residues: 28, 29, 30, 31, 33, 34, 43
3D-footprint Homologues: 3u3w_B
Binding Motifs: 4jcx_AB CTAAnTnnnnnTTAG
Binding Sites: 4jcx_C
4jcx_D
Publications: Shevtsov M.B, Streeter S.D, Thresh S.J, Swiderska A, McGeehan J.E, Kneale G.G. Structural analysis of DNA binding by C.Csp231I, a member of a novel class of R-M controller proteins regulating gene expression. Acta crystallographica. Section D, Biological crystallography 71:398-407 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.