Transcription Factor
| Accessions: | Q8W191 (JASPAR 2024) |
| Names: | AtbZIP64, bZIP transcription factor 64, HY5 homolog, HYH_ARATH, Transcription factor HY5-like |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q8W191 |
| Length: | 149 |
| Pfam Domains: | 77-136 bZIP transcription factor 80-130 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MSLQRPNGNSSSSSSHKKHKTEESDEELLMVPDMEAAGSTCVLSSSADDGVNNPELDQTQ 60 61 NGVSTAKRRRGRNPVDKEYRSLKRLLRNRVSAQQARERKKVYVSDLESRANELQNNNDQL 120 121 EEKISTLTNENTMLRKMLINTRPKTDDNH |
| Interface Residues: | 84, 88, 89, 91, 92, 95, 96 |
| 3D-footprint Homologues: | 7x5e_F, 5t01_B, 5vpe_D, 1dh3_C |
| Binding Motifs: | MA1425.1 grwsACGTGkca MA1425.2 wsACGTG |
| Publications: | Holm M., Ma L. G., Qu L. J., Deng X. W. Two interacting bZIP proteins are direct targets of COP1-mediated control of light-dependent gene expression in Arabidopsis.. Genes Dev. 16:1247-1259 (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.