Transcription Factor
| Accessions: | ZFP41 (HT-SELEX2 May2017), Q8N8Y5 (JASPAR 2024) |
| Names: | ENSG00000181638, ZFP41, Zfp-41, ZFP41_HUMAN, Zinc finger protein 41 homolog |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, JASPAR 2024 2 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
| Length: | 198 |
| Pfam Domains: | 86-105 C2H2-type zinc finger 87-109 C2H2-type zinc finger 87-109 Zinc finger, C2H2 type 104-126 Zinc-finger double domain 115-137 C2H2-type zinc finger 115-137 C2H2-type zinc finger 115-137 Zinc finger, C2H2 type 131-153 Zinc-finger double domain 143-165 C2H2-type zinc finger 143-165 C2H2-type zinc finger 143-165 Zinc finger, C2H2 type 157-182 Zinc-finger double domain 170-193 C2H2-type zinc finger 171-193 C2H2-type zinc finger 171-193 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHV 60 61 FDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHTGEKPFKCAQC 120 121 GKAFRHSSDVTKHQRTHTGEKPFKCGECGKAFNCGSNLLKHQKTHTGEKPYECTHCGKAF 180 181 AYSSCLIRHQKRHPRKKP |
| Interface Residues: | 87, 97, 98, 99, 100, 101, 102, 103, 104, 106, 107, 108, 110, 125, 126, 127, 128, 129, 131, 132, 133, 153, 154, 155, 156, 157, 158, 159, 160, 161, 181, 182, 183, 184, 185, 187, 188, 192 |
| 3D-footprint Homologues: | 2kmk_A, 5v3j_F, 6blw_A, 6jnm_A, 5k5i_A, 8ssq_A, 7w1m_H, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 1tf6_A, 8gn3_A, 5ei9_F, 1g2f_F, 7ysf_A, 2lt7_A, 6e94_A, 6a57_A, 1ubd_C, 2jpa_A, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 7txc_E, 1llm_D, 6ml4_A, 2drp_D, 5k5l_F, 6u9q_A, 5yel_A, 4x9j_A, 5kl3_A, 8h9h_G, 4m9v_C, 2wbs_A, 5yj3_D, 7y3m_I |
| Binding Motifs: | UN0154.1 / ZFP41_2 yGCTAACTCTCCrcr ZFP41_methyl_1 yGCTAACTCTCCrCr UN0154.2 GCTAACTCTCCrc |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.