Transcription Factor

Accessions: ZFP41 (HT-SELEX2 May2017), Q8N8Y5 (JASPAR 2024)
Names: ENSG00000181638, ZFP41, Zfp-41, ZFP41_HUMAN, Zinc finger protein 41 homolog
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1, JASPAR 2024 2
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2
Length: 198
Pfam Domains: 86-105 C2H2-type zinc finger
87-109 C2H2-type zinc finger
87-109 Zinc finger, C2H2 type
104-126 Zinc-finger double domain
115-137 C2H2-type zinc finger
115-137 Zinc finger, C2H2 type
115-137 C2H2-type zinc finger
131-153 Zinc-finger double domain
143-165 C2H2-type zinc finger
143-165 C2H2-type zinc finger
143-165 Zinc finger, C2H2 type
157-182 Zinc-finger double domain
170-193 C2H2-type zinc finger
171-193 C2H2-type zinc finger
171-193 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHV 60
61 FDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHTGEKPFKCAQC 120
121 GKAFRHSSDVTKHQRTHTGEKPFKCGECGKAFNCGSNLLKHQKTHTGEKPYECTHCGKAF 180
181 AYSSCLIRHQKRHPRKKP
Interface Residues: 87, 97, 98, 99, 100, 101, 102, 103, 104, 106, 107, 108, 110, 125, 126, 127, 128, 129, 131, 132, 133, 153, 154, 155, 156, 157, 158, 159, 160, 161, 181, 182, 183, 184, 185, 187, 188, 192
3D-footprint Homologues: 2kmk_A, 5v3j_F, 6blw_A, 6jnm_A, 8ssq_A, 7w1m_H, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 1tf6_A, 8gn3_A, 5ei9_F, 1g2f_F, 5k5i_A, 7ysf_A, 2lt7_A, 6e94_A, 6a57_A, 2jpa_A, 1ubd_C, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 1llm_D, 6ml4_A, 2drp_D, 5k5l_F, 6u9q_A, 5yel_A, 4x9j_A, 5kl3_A, 7txc_E, 4m9v_C, 8h9h_G, 2wbs_A, 5yj3_D, 7y3m_I
Binding Motifs: UN0154.1 / ZFP41_2 yGCTAACTCTCCrcr
ZFP41_methyl_1 yGCTAACTCTCCrCr
UN0154.2 GCTAACTCTCCrc
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.