Transcription Factor

						

			
Accessions: 4lup_A (3D-footprint 20231221)

			
Names: Q0P6M2_ECOLX, RNA polymerase sigma factor
Organisms: Escherichia coli
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q0P6M2
Length: 91
Pfam Domains:     21-88 Sigma-70 region 2 
Sequence: 
(in bold interface residues)		   1 LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSF   60
  61 RGDSAFYTWLYRIAVNTAKNYLVAQGRRLEL
Interface Residues: 52, 56, 60, 61, 63, 64, 67, 68, 69, 71, 72, 73, 76, 80
3D-footprint Homologues: 4lup_A
Binding Motifs: 4lup_A tGTCnaA
Binding Sites: 4lup_B
			
Publications: Campagne S, Marsh M.E, Capitani G, Vorholt J.A, Allain F.H. Structural basis for -10 promoter element melting by environmentally induced sigma factors. Nature structural & molecular biology 21:269-76 (2014). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.