Transcription Factor

						

			
Accessions: 4ond_E (3D-footprint 20231221), 4ond_F (3D-footprint 20231221)

			
Names: Ancestral SR2 Helix Mutant
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 71
Pfam Domains:      3-70 Zinc finger, C4 type (two domains)
Sequence: 
(in bold interface residues)		   1 QKVCLICGDEASGCHYGVLTCEGCKAFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR   60
  61 LRKCLQAGMTL
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A
Binding Motifs: 4ond_EF GGTCAnnnTGACCT
Binding Sites: 4ond_K
4ond_L
			
Publications: McKeown A.N, Bridgham J.T, Anderson D.W, Murphy M.N, Ortlund E.A, Thornton J.W. Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module. Cell 159:58-68 (2014). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.