Transcription Factor

						

			
Accessions: 1puf_B (3D-footprint 20231221)

			
Names: Homeobox protein PBX1, Homeobox protein PRL, PBX1_HUMAN, Pre-B-cell leukemia transcription factor 1, Pre-B-cell leukemia transcription factor-1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P40424
Length: 73
Pfam Domains:      2-61 Homeobox domain
    20-58 Homeobox KN domain
Sequence: 
(in bold interface residues)		   1 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK   60
  61 KNIGKFQEEANIY
Interface Residues: 2, 3, 4, 5, 46, 47, 49, 50, 53, 54, 57, 58, 61
3D-footprint Homologues: 3cmy_A, 6a8r_A, 3d1n_M, 1fjl_B, 5zfz_A, 6fqp_B, 1puf_A, 2lkx_A, 1zq3_P, 1b72_A, 5hod_A, 1puf_B, 3l1p_A, 4j19_B, 1au7_A, 5zjt_E, 5jlw_D, 2ld5_A, 1le8_A, 1ig7_A, 7q3o_C, 1ic8_B, 4qtr_D, 2h1k_B, 6fqq_E, 3rkq_B, 8g87_X, 4xrm_B, 2hdd_A, 1le8_B, 6m3d_C, 1du0_A, 4cyc_A, 2r5y_A, 1jgg_B, 6es3_K, 4xrs_G, 1mnm_C, 7psx_B, 3a01_E, 2d5v_B, 1k61_B, 5flv_I, 3lnq_A, 2hos_A
Binding Motifs: 1puf_AB ATGATwTACnAC
1puf_B TaTCAT
Binding Sites: 1puf_D
1puf_E
			
Publications: LaRonde-LeBlanc N.A, Wolberger C. Structure of HoxA9 and Pbx1 bound to DNA: Hox hexapeptide and DNA recognition anterior to posterior. Genes & development 17:2060-72 (2003). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.