Transcription Factor

Accessions: Q4H376 (JASPAR 2024)
Names: Fragment, Myc-associated factor X, Protein max, Q4H376_CIOIN
Organisms: Ciona intestinalis
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q4H376
Length: 127
Pfam Domains: 22-71 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 EDRDVDVDSDVDDKDSGNGLSKRSHHNALERKRRDHIKESFNGLRDSVPSLQGEKTSRAQ 60
61 ILNKATEYIQDVSRKNNADRQDIDELKKQNNQLEMRIRALEHAKQDGIFASRQNNSNDQE 120
121 LDVENDS
Interface Residues: 23, 25, 26, 27, 29, 30, 33, 34, 38, 58
3D-footprint Homologues: 8osb_B, 1an4_A, 5eyo_A, 7xq5_A, 5v0l_A, 1am9_A, 7rcu_E, 5gnj_I, 6g1l_A, 7ssa_L, 5i50_B, 8hov_A, 7d8t_A, 4zpk_A, 7xi3_A, 5nj8_D, 8ia3_B, 7f2f_B, 7z5k_B
Binding Motifs: MA1897.1 kgktdrmCACGTGkyhamcm
MA1897.2 CACGTG
Publications: José-Edwards DS, Oda-Ishii I, Kugler JE, Passamaneck YJ, Katikala L, Nibu Y, Di Gregorio A. Brachyury, Foxa2 and the cis-Regulatory Origins of the Notochord. PLoS Genet : (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.