Transcription Factor
| Accessions: | 2h1k_B (3D-footprint 20231221) |
| Names: | Homeodomain protein PDX1, Insulin promoter factor 1, IPF-1, Pancreas/duodenum homeobox protein 1, Pancreatic and duodenal homeobox 1, PDX1_MESAU |
| Organisms: | Mesocricetus auratus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P70118 |
| Length: | 60 |
| Pfam Domains: | 2-58 Homeobox domain |
| Sequence: (in bold interface residues) | 1 NKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEE 60 |
| Interface Residues: | 2, 3, 4, 5, 43, 44, 46, 47, 50, 51, 54, 55, 58 |
| 3D-footprint Homologues: | 3cmy_A, 5zfz_A, 1fjl_B, 1ig7_A, 6a8r_A, 2h1k_B, 1puf_A, 6m3d_C, 1zq3_P, 1jgg_B, 3lnq_A, 2lkx_A, 2ld5_A, 6es3_K, 4xrs_G, 2hdd_A, 1au7_A, 3rkq_B, 2r5y_A, 5flv_I, 3d1n_M, 2hos_A, 1nk2_P, 1b72_A, 5zjt_E, 4cyc_A, 7psx_B, 5hod_A, 3l1p_A, 3a01_E, 7q3o_C, 5jlw_D, 1e3o_C, 1le8_A, 7xrc_C, 2xsd_C, 1puf_B, 8g87_X, 1o4x_A, 1du0_A, 4qtr_D |
| Binding Motifs: | 2h1k_B CTAAnAA |
| Binding Sites: | 2h1k_E 2h1k_F |
| Publications: | Longo A, Guanga G.P, Rose R.B. Structural basis for induced fit mechanisms in DNA recognition by the Pdx1 homeodomain. Biochemistry 46:2948-57 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.