Transcription Factor

Accessions: 5nnx_A (3D-footprint 20231221)
Names: NTEF-1, Protein GT-IIC, TCF-13, TEA domain family member 1, TEAD-1, TEAD1_HUMAN, Transcription factor 13, Transcriptional enhancer factor TEF-1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P28347
Length: 74
Pfam Domains: 1-69 TEA/ATTS domain family
Sequence:
(in bold interface residues)
1 AEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQV 60
61 SSHIQVLARRKSRD
Interface Residues: 36, 40, 57, 58, 61, 62, 65, 66, 69
3D-footprint Homologues: 5gzb_A, 5no6_N
Binding Motifs: 5nnx_A gGAATk
Binding Sites: 5nnx_C
5nnx_F
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.