Transcription Factor

Accessions: 4xic_A (3D-footprint 20250804)
Names: ANTP_DROME, Homeotic protein antennapedia
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P02833
Length: 59
Pfam Domains: 1-57 Homeobox domain
Sequence:
(in bold interface residues)
1 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Interface Residues: 1, 2, 3, 4, 5, 42, 43, 45, 46, 49, 50, 52, 53, 54, 57
3D-footprint Homologues: 1puf_A, 1ig7_A, 8ejp_B, 6a8r_A, 1fjl_B, 3cmy_A, 8pmf_A, 5zfz_A, 6m3d_C, 3d1n_M, 1jgg_B, 3lnq_A, 1zq3_P, 2lkx_A, 2r5y_A, 5flv_I, 2hos_A, 9b8u_A, 5zjt_E, 8ik5_C, 7psx_B, 5hod_A, 2ld5_A, 1nk2_P, 3a01_E, 8osb_E, 7q3o_C, 5jlw_D, 3rkq_B, 8eml_B, 6es3_K, 4xrs_G, 2hdd_A, 1b72_A, 4cyc_A, 4j19_B, 2xsd_C, 1e3o_C, 1au7_A, 1le8_A, 7xrc_C, 8g87_X, 1mnm_C, 8bx1_A, 1du0_A, 1puf_B, 4qtr_D, 1k61_B, 1o4x_A
Binding Motifs: 4xic_A CTAAtg
Binding Sites: 4xic_C
4xic_B
Publications: Zandarashvili L, Nguyen D, Anderson KM, White MA, Gorenstein DG, Iwahara J. Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate. Biophys J 109:1026-37 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.