Transcription Factor

Accessions: klu (FlyZincFinger 1.0 )
Names: CG12296
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 147
Pfam Domains: 31-53 C2H2-type zinc finger
31-54 C2H2-type zinc finger
31-54 Zinc finger, C2H2 type
67-89 C2H2-type zinc finger
67-89 C2H2-type zinc finger
67-89 Zinc finger, C2H2 type
82-106 Zinc-finger double domain
94-117 C2H2-type zinc finger
95-117 Zinc finger, C2H2 type
95-117 C2H2-type zinc finger
109-131 Zinc-finger double domain
123-145 C2H2-type zinc-finger domain
123-145 Zinc finger, C2H2 type
123-145 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 SPTTKETVAWRYNLDVSPVVEEMPPGSDVAYVCPTCGQMFSLHDRLAKHMASRHKSRNPA 60
61 NDIAKAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGE 120
121 KPYKCPQCPYAACRRDMITRHMRTHTR
Interface Residues: 41, 42, 43, 44, 45, 47, 48, 52, 53, 56, 67, 77, 78, 79, 80, 81, 83, 84, 85, 86, 87, 105, 106, 107, 108, 109, 111, 112, 113, 116, 130, 132, 134, 135, 136, 137, 138, 139, 140, 141
3D-footprint Homologues: 6jnm_A, 8ssq_A, 7w1m_H, 5v3j_F, 2i13_A, 5kkq_D, 8ssu_A, 5ei9_F, 2drp_D, 7eyi_G, 7ysf_A, 6e94_A, 6wmi_A, 6a57_A, 5yel_A, 1ubd_C, 6ml4_A, 2kmk_A, 8cuc_F, 7n5w_A, 1tf3_A, 2gli_A, 1g2f_F, 5k5l_F, 1tf6_A, 4x9j_A, 6blw_A, 2jpa_A, 1mey_C, 5kl3_A, 1f2i_J, 5k5i_A, 5und_A, 8h9h_G, 2lt7_A, 7y3m_I, 8gn3_A, 7ef9_A, 7y3l_A, 3uk3_C, 1llm_D, 2wbs_A, 6u9q_A, 7txc_E, 4m9v_C, 5yj3_D
Binding Motifs: klu_SANGER_10_FBgn0013469 tGyGkGGGTGk
klu_SOLEXA_5_FBgn0013469 kGyGkGGGTGkkkkk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.