Transcription Factor
Accessions: | klu (FlyZincFinger 1.0 ) |
Names: | CG12296 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 147 |
Pfam Domains: | 31-53 C2H2-type zinc finger 31-54 C2H2-type zinc finger 31-54 Zinc finger, C2H2 type 67-89 C2H2-type zinc finger 67-89 C2H2-type zinc finger 67-89 Zinc finger, C2H2 type 82-106 Zinc-finger double domain 94-117 C2H2-type zinc finger 95-117 Zinc finger, C2H2 type 95-117 C2H2-type zinc finger 109-131 Zinc-finger double domain 123-145 C2H2-type zinc-finger domain 123-145 Zinc finger, C2H2 type 123-145 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 SPTTKETVAWRYNLDVSPVVEEMPPGSDVAYVCPTCGQMFSLHDRLAKHMASRHKSRNPA 60 61 NDIAKAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGE 120 121 KPYKCPQCPYAACRRDMITRHMRTHTR |
Interface Residues: | 41, 42, 43, 44, 45, 47, 48, 52, 53, 56, 67, 77, 78, 79, 80, 81, 83, 84, 85, 86, 87, 105, 106, 107, 108, 109, 111, 112, 113, 116, 130, 132, 134, 135, 136, 137, 138, 139, 140, 141 |
3D-footprint Homologues: | 6jnm_A, 8ssq_A, 7w1m_H, 5v3j_F, 2i13_A, 5kkq_D, 8ssu_A, 5ei9_F, 2drp_D, 7eyi_G, 7ysf_A, 6e94_A, 6wmi_A, 6a57_A, 5yel_A, 1ubd_C, 6ml4_A, 2kmk_A, 8cuc_F, 7n5w_A, 1tf3_A, 2gli_A, 1g2f_F, 5k5l_F, 1tf6_A, 4x9j_A, 6blw_A, 2jpa_A, 1mey_C, 5kl3_A, 1f2i_J, 5k5i_A, 5und_A, 8h9h_G, 2lt7_A, 7y3m_I, 8gn3_A, 7ef9_A, 7y3l_A, 3uk3_C, 1llm_D, 2wbs_A, 6u9q_A, 7txc_E, 4m9v_C, 5yj3_D |
Binding Motifs: | klu_SANGER_10_FBgn0013469 tGyGkGGGTGk klu_SOLEXA_5_FBgn0013469 kGyGkGGGTGkkkkk |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.