Transcription Factor

						

			
Accessions: 1zlk_A (3D-footprint 20231221), 1zlk_B (3D-footprint 20231221)

			
Names: DEVR_MYCTU, Dormancy Survival Regulator
Organisms: Mycobacterium tuberculosis, strain ATCC 25618 / H37Rv
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 65
Pfam Domains:      5-60 Bacterial regulatory proteins, luxR family
     5-48 Sigma-70, region 4
Sequence: 
(in bold interface residues)		   1 DPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFA   60
  61 TELKR
Interface Residues: 33, 34, 35, 36, 38, 39, 40, 42
3D-footprint Homologues: 7ve5_B, 5w43_B, 4wuh_B, 1je8_F, 6ide_A, 1zlk_A
Binding Motifs: 1zlk_A aGTCCCt
1zlk_AB AGGGACTnnAGTCCC
Binding Sites: 1zlk_C
1zlk_D
			
Publications: Wisedchaisri G, Wu M, Rice A.E, Roberts D.M, Sherman D.R, Hol W.G. Structures of Mycobacterium tuberculosis DosR and DosR-DNA complex involved in gene activation during adaptation to hypoxic latency. Journal of molecular biology 354:630-41 (2005). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.