Transcription Factor
| Accessions: | 1zlk_A (3D-footprint 20250804), 1zlk_B (3D-footprint 20250804) |
| Names: | DEVR_MYCTU, Dormancy Survival Regulator |
| Organisms: | Mycobacterium tuberculosis, strain ATCC 25618 / H37Rv |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 65 |
| Pfam Domains: | 5-48 Sigma-70, region 4 5-60 Bacterial regulatory proteins, luxR family |
| Sequence: (in bold interface residues) | 1 DPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFA 60 61 TELKR |
| Interface Residues: | 23, 33, 34, 35, 36, 38, 39, 40, 41, 42 |
| 3D-footprint Homologues: | 8u3b_G, 7ve5_B, 5w43_B, 4wuh_B, 6ide_A, 1zlk_A |
| Binding Motifs: | 1zlk_A aGTCCCt 1zlk_AB AGGGACTnnAGTCCC |
| Binding Sites: | 1zlk_C 1zlk_D |
| Publications: | Wisedchaisri G, Wu M, Rice A.E, Roberts D.M, Sherman D.R, Hol W.G. Structures of Mycobacterium tuberculosis DosR and DosR-DNA complex involved in gene activation during adaptation to hypoxic latency. Journal of molecular biology 354:630-41 (2005). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.