Transcription Factor
Accessions: | 2ayb_A (3D-footprint 20231221), 2ayb_B (3D-footprint 20231221), 2ayg_A (3D-footprint 20231221), 2ayg_B (3D-footprint 20231221) |
Names: | Regulatory protein E2, VE2_HPV6A |
Organisms: | Human papillomavirus type 6a |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q84294 |
Length: | 87 |
Pfam Domains: | 5-83 E2 (early) protein, C terminal |
Sequence: (in bold interface residues) | 1 SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEE 60 61 QRQQFLNVVKIPPTIRHKLGFMSMHLL |
Interface Residues: | 14, 17, 18, 20, 21, 22, 44, 46, 50, 56 |
3D-footprint Homologues: | 1jj4_B, 2ayg_A, 2bop_A, 7rcf_A |
Binding Motifs: | 2ayb_AB CAACCGnnnnCGGTTG 2ayb_B CGGTTG 2ayg_A CGGTTG 2ayg_AB CAACCGnnnnCGGTTG |
Binding Sites: | 2ayb_C / 2ayb_D 2ayg_C / 2ayg_D |
Publications: | Hooley E, Fairweather V, Clarke A.R, Gaston K, Brady R.L. The recognition of local DNA conformation by the human papillomavirus type 6 E2 protein. Nucleic acids research 34:3897-908 (2006). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.