Transcription Factor

Accessions: 1nkp_E (3D-footprint 20231221)
Names: bHLHd4, Class D basic helix-loop-helix protein 4, Max protein, MAX_HUMAN, Myc-associated factor X, Protein max
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P61244
Length: 81
Pfam Domains: 1-50 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 RAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQD 60
61 IDDLKRQNALLEQQVRALGGC
Interface Residues: 1, 3, 4, 5, 7, 8, 11, 12, 16, 36
3D-footprint Homologues: 1a0a_B, 1an4_A, 7rcu_E, 5gnj_I, 6g1l_A, 4h10_A, 7ssa_L, 5i50_B, 7d8t_A, 4zpk_A, 7xi3_A, 5nj8_D, 1am9_A, 7f2f_B, 5eyo_A, 7xq5_A, 5v0l_A, 7z5k_B
Binding Motifs: 1nkp_DE CACGTGc
1nkp_E gCACg
Binding Sites: 1nkp_H / 1nkp_J
Publications: Nair S.K, Burley S.K. X-ray structures of Myc-Max and Mad-Max recognizing DNA. Molecular bases of regulation by proto-oncogenic transcription factors. Cell 112:193-205 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.