Transcription Factor
Accessions: | Q7RTS1 (JASPAR 2024) |
Names: | BHA15_HUMAN, bHLHa15, bHLHb8, Class A basic helix-loop-helix protein 15, Class B basic helix-loop-helix protein 8, MIST-1, Muscle, intestine and stomach expression 1 |
Organisms: | Homo sapiens |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | Q7RTS1 |
Length: | 189 |
Pfam Domains: | 76-127 Helix-loop-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRR 60 61 PGPSGPGGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLA 120 121 KNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYST 180 181 QIHSFREGT |
Interface Residues: | 77, 79, 80, 81, 83, 84, 85, 87, 88, 111, 113 |
3D-footprint Homologues: | 7z5k_B, 2ypa_A, 1an4_A, 7ssa_L, 5i50_B, 4h10_A, 5eyo_A, 6od3_F, 2ypa_B, 2ql2_A, 2ql2_D, 5v0l_A, 5gnj_I, 7xhv_B |
Binding Motifs: | UN0525.1 wcCGGAAACATATGk MA1472.1 avCAGCTGyy MA0607.2 aCCATATGGt UN0525.2 cCGGAAACATATGk |
Publications: | Lemercier C., To R. Q., Carrasco R. A., Konieczny S. F. The basic helix-loop-helix transcription factor Mist1 functions as a transcriptional repressor of myoD. EMBO J. 17:1412-22 (1998). [Pubmed] Lo HG, Jin RU, Sibbel G, Liu D, Karki A, Joens MS, Madison BB, Zhang B, Blanc V, Fitzpatrick JA, Davidson NO, Konieczny SF, Mills JC. A single transcription factor is sufficient to induce and maintain secretory cell architecture. Genes Dev 31:154-171 (2017). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.