Transcription Factor
| Accessions: | SP1 (HT-SELEX2 May2017) |
| Names: | ENSG00000185591, SP1 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
| Length: | 182 |
| Pfam Domains: | 76-100 C2H2-type zinc finger 76-100 Zinc finger, C2H2 type 92-119 Zinc-finger double domain 106-130 Zinc finger, C2H2 type 108-130 C2H2-type zinc finger 123-145 Zinc-finger double domain 136-158 C2H2-type zinc finger 136-158 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 PLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCK 60 61 DSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRS 120 121 DELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGA 180 181 GS |
| Interface Residues: | 60, 65, 67, 69, 88, 89, 90, 91, 92, 94, 95, 97, 98, 101, 118, 119, 120, 121, 122, 124, 125, 126, 129, 146, 147, 148, 149, 150, 151, 152, 153, 154, 157 |
| 3D-footprint Homologues: | 7ysf_A, 5yel_A, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 8gn3_A, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 5v3j_F, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 2jpa_A, 3uk3_C, 8cuc_F, 1llm_D, 2drp_D, 5yj3_D, 1f2i_J, 2wbs_A, 7txc_E, 4m9v_C |
| Binding Motifs: | SP1_2 ywrRCCACGCCCmCh SP1_methyl_1 twrGCCmCGCCCmCw |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.