Transcription Factor

Accessions: SP1 (HT-SELEX2 May2017)
Names: ENSG00000185591, SP1
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2
Length: 182
Pfam Domains: 76-100 C2H2-type zinc finger
76-100 Zinc finger, C2H2 type
92-119 Zinc-finger double domain
106-130 Zinc finger, C2H2 type
108-130 C2H2-type zinc finger
123-145 Zinc-finger double domain
136-158 C2H2-type zinc finger
136-158 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 PLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCK 60
61 DSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRS 120
121 DELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGA 180
181 GS
Interface Residues: 60, 65, 67, 69, 88, 89, 90, 91, 92, 94, 95, 97, 98, 101, 118, 119, 120, 121, 122, 124, 125, 126, 129, 146, 147, 148, 149, 150, 151, 152, 153, 154, 157
3D-footprint Homologues: 7ysf_A, 5yel_A, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 6blw_A, 5k5i_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 8gn3_A, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 1ubd_C, 8ssq_A, 7w1m_H, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 2jpa_A, 8cuc_F, 3uk3_C, 1llm_D, 2drp_D, 5yj3_D, 1f2i_J, 2wbs_A, 7txc_E, 4m9v_C
Binding Motifs: SP1_2 ywrRCCACGCCCmCh
SP1_methyl_1 twrGCCmCGCCCmCw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.