Transcription Factor
| Accessions: | POU4F3_DBD (HumanTF 1.0) |
| Names: | Brain-3C, Brain-specific homeobox/POU domain protein 3C, Brn-3C, PO4F3_HUMAN, POU domain, class 4, transcription factor 3, POU4F3 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Uniprot: | Q15319 |
| Notes: | Ensembl ID: ENSG00000091010; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Gene synthesis |
| Length: | 180 |
| Pfam Domains: | 23-98 Pou domain - N-terminal to homeobox domain 117-173 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MAMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIP 60 61 GVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKR 120 121 TSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 180 |
| Interface Residues: | 47, 48, 66, 67, 68, 69, 71, 72, 78, 82, 117, 118, 119, 120, 158, 159, 161, 162, 165, 166, 169, 170, 173 |
| 3D-footprint Homologues: | 3cro_R, 7u0g_M, 3d1n_M, 3l1p_A, 2xsd_C, 1au7_A, 7xrc_C, 1o4x_A, 8g87_X, 1e3o_C, 2h1k_B, 1fjl_B, 3cmy_A, 5zfz_A, 1puf_A, 1nk2_P, 1zq3_P, 2lkx_A, 1jgg_B, 3lnq_A, 2ld5_A, 5zjt_E, 3rkq_B, 1puf_B, 5hod_A, 3a01_E, 1ig7_A, 1b72_A, 7psx_B, 2d5v_B, 2r5y_A, 5jlw_D, 1le8_A, 7q3o_C, 5flv_I, 6es3_K, 4qtr_D, 4xrs_G |
| Binding Motifs: | POU4F3_DBD aTgmATwATTaATgag |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.