Transcription Factor

Accessions: POU4F3_DBD (HumanTF 1.0)
Names: Brain-3C, Brain-specific homeobox/POU domain protein 3C, Brn-3C, PO4F3_HUMAN, POU domain, class 4, transcription factor 3, POU4F3
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q15319
Notes: Ensembl ID: ENSG00000091010; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Gene synthesis
Length: 180
Pfam Domains: 23-98 Pou domain - N-terminal to homeobox domain
117-173 Homeobox domain
Sequence:
(in bold interface residues)
1 MAMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIP 60
61 GVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKR 120
121 TSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH 180
Interface Residues: 47, 48, 66, 67, 68, 69, 71, 72, 78, 82, 117, 118, 119, 120, 158, 159, 161, 162, 165, 166, 168, 169, 170, 173
3D-footprint Homologues: 3cro_R, 8bx1_A, 3d1n_M, 7u0g_M, 1o4x_A, 7xrc_C, 8g87_X, 2xsd_C, 1e3o_C, 1au7_A, 1puf_A, 5zfz_A, 1fjl_B, 8ejp_B, 3cmy_A, 1jgg_B, 3lnq_A, 2lkx_A, 1nk2_P, 1zq3_P, 2ld5_A, 2r5y_A, 8pmf_A, 1b72_A, 2d5v_B, 7psx_B, 9b8u_A, 8ik5_C, 3a01_E, 1puf_B, 5zjt_E, 8osb_E, 5hod_A, 1ig7_A, 8eml_B, 5jlw_D, 1le8_A, 7q3o_C, 6es3_K, 4qtr_D, 4xrs_G, 5flv_I
Binding Motifs: POU4F3_DBD aTgmATwATTaATgag
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.