Transcription Factor

Accessions: CG14962 (FlyZincFinger 1.0 )
Names: CG14962
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 139
Pfam Domains: 15-39 C2H2-type zinc finger
54-87 C2H2-type zinc finger
115-136 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KHTPDIRELMPVREHRCERCPSLVFGNLSHYQLHLRRRHQEVIPPSVIGPIVAFHCPVEK 60
61 CIYHVATKGARSFTSLRLLRQHYQKSHLDKNYKCLACGGKFLLQHHLEKHQCSKHKCPVC 120
121 ELTYNSKAGLRTHMRRKNH
Interface Residues: 29, 74, 75, 76, 77, 78, 80, 81, 99, 101, 102, 103, 104, 105, 106, 109, 125, 126, 127, 128, 129, 131, 132, 136
3D-footprint Homologues: 7y3m_I, 8cuc_F, 2kmk_A, 7ysf_A, 1llm_D, 6wmi_A, 1mey_C, 8h9h_G, 7n5w_A, 2i13_A, 5ei9_F, 1f2i_J, 5v3j_F, 2lt7_A, 6e94_A, 8ssq_A, 5k5i_A, 8ssu_A, 5kkq_D, 5und_A, 3uk3_C, 7w1m_H, 7txc_E, 5yj3_D, 6ml4_A, 7y3l_A, 5yel_A
Binding Motifs: CG14962_SANGER_5_FBgn0035407 mAarwTGAAACAC
CG14962_SOLEXA_5_FBgn0035407 aAagWTGAArCAC
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.