Transcription Factor

						

			
Accessions: 1k61_B (3D-footprint 20231221)

			
Names: Alpha-2 repressor, MATalpha2 protein, Mating-type protein alpha-2, Mating-type protein ALPHA2, MTAL2_YEAST
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CY08
Length: 59
Pfam Domains:      4-57 Homeobox domain
    16-54 Homeobox KN domain
Sequence: 
(in bold interface residues)		   1 RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTI
Interface Residues: 1, 3, 4, 43, 44, 46, 47, 50, 51, 54, 55, 58
3D-footprint Homologues: 1mnm_C, 1k61_B, 1le8_B, 4j19_B, 2ld5_A, 5jlw_D, 2xsd_C, 7q3o_C, 1e3o_C, 7xrc_C, 1ig7_A, 7psx_B, 4xrs_G, 1nk2_P, 1du0_A, 6es3_K, 3rkq_B, 5flv_I, 3a01_E, 1puf_B, 6fqp_B, 3cmy_A, 1zq3_P, 6fqq_E, 4xrm_B, 2lkx_A, 8g87_X, 1b72_A, 5zjt_E, 3d1n_M, 2hdd_A, 1jgg_B, 2hos_A
Binding Motifs: 1k61_ABCD GCTTGTAAAnGAATTACA
1k61_B TGTAntTnnnnnrC
Binding Sites: 1k61_E
1k61_F
			
Publications: Aishima J, Gitti R.K, Noah J.E, Gan H.H, Schlick T, Wolberger C. A Hoogsteen base pair embedded in undistorted B-DNA. Nucleic acids research 30:5244-52 (2002). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.