Transcription Factor
Accessions: | 1nkp_B (3D-footprint 20241219) |
Names: | bHLHd4, Class D basic helix-loop-helix protein 4, Max protein, MAX_HUMAN, Myc-associated factor X, Protein max |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P61244 |
Length: | 83 |
Pfam Domains: | 2-52 Helix-loop-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQ 60 61 QDIDDLKRQNALLEQQVRALGGC |
Interface Residues: | 3, 6, 7, 9, 10, 13, 14, 18, 38 |
3D-footprint Homologues: | 8osb_B, 7z5k_B, 8ia3_B, 7f2f_B, 7xq5_A, 7rcu_E, 5v0l_A, 8osl_O, 7ssa_L, 8hov_A, 7d8t_A, 7xi3_A |
Binding Motifs: | 1nkp_AB gCACGTGCT |
Binding Sites: | 1nkp_F / 1nkp_G |
Publications: | Nair S.K, Burley S.K. X-ray structures of Myc-Max and Mad-Max recognizing DNA. Molecular bases of regulation by proto-oncogenic transcription factors. Cell 112:193-205 (2003). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.