Transcription Factor

						

			
Accessions: 5yzy_C (3D-footprint 20231221), 5yzz_C (3D-footprint 20231221), 5z00_K (3D-footprint 20231221)

			
Names: B3 domain-containing transcription repressor VAL1, Protein HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2, Protein VP1/ABI3-LIKE 1, VAL1_ARATH
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 111
Pfam Domains:     9-107 B3 DNA binding domain
Sequence: 
(in bold interface residues)		   1 LNLNIVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQDVRGREWTFQF   60
  61 RYWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGGKLIMGSRKAAN
Interface Residues: 14, 16, 21, 22, 23, 25, 61, 63, 64, 65, 66, 67, 68, 69, 70
3D-footprint Homologues: 6j9b_A, 6ycq_A, 7et6_A, 6j9c_D, 6sdg_B, 6fas_B
Binding Motifs: 5yzy_C cATGCa
5yzz_C CATGCa
5z00_K gCATg
Binding Sites: 5yzy_A / 5yzz_A
5yzy_B / 5yzz_B
5z00_I
5z00_J
			
Publications: Wu B, Zhang M, Su S, Liu H, Gan J, Ma J. Structural insight into the role of VAL1 B3 domain for targeting to FLC locus in Arabidopsis thaliana. Biochem Biophys Res Commun 501:415-422 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.