Transcription Factor

						

			
Accessions: 1dp7_P (3D-footprint 20231221)

			
Names: EF-C, Enhancer factor C, MHC class II regulatory factor RFX1, MHC CLASS II TRANSCRIPTION FACTOR HRFX1, Regulatory factor X 1, RFX1_HUMAN, Transcription factor RFX1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P22670
Length: 76
Pfam Domains:      2-66 RFX DNA-binding domain
Sequence: 
(in bold interface residues)		   1 TVQWLLDNYETAEGVSLPRSTLYNHYLLHSQEQKLEPVNAASFGKLIRSVFMGLRTRRLG   60
  61 TRGNSKYHYYGLRIKA
Interface Residues: 41, 45, 58, 62, 67
3D-footprint Homologues: 1dp7_P
Binding Motifs: 1dp7_P aCcnGGnna
Binding Sites: 1dp7_D
			
Publications: Gajiwala K. S., Chen H., Cornille F., Roques B. P., Reith W., Mach B., Burley S. K. Structure of the winged-helix protein hRFX1 reveals a new mode of DNA binding.. Nature 403:916-921 (2000). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.