Transcription Factor

Accessions: ZBED1_DBD (HumanTF 1.0), ZBED1 (HT-SELEX2 May2017)
Names: dREF homolog, Putative Ac-like transposable element, ZBED1, ZBED1_HUMAN, Zinc finger BED domain-containing protein 1, ENSG00000214717
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: O96006
Notes: Ensembl ID: ENSG00000214717; DNA-binding domain sequence; TF family: znfBED; Clone source: Megaman, TF family: Znf_BED experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Znf_BED experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 88
Pfam Domains: 19-68 BED zinc finger
Sequence: SLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLS
YHLEKNHPEEFCEFVKSNTEQMREAFAT
Binding Motifs: ZBED1_DBD cTrTCGCGACATr
ZBED1_2 mTrTCGCGAyAT
ZBED1_methyl_1 mTrTCGCGAyAk
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.