Transcription Factor

Accessions: 6ml4_A (3D-footprint 20241219), 6ml6_A (3D-footprint 20241219), 6ml7_A (3D-footprint 20241219)
Names: Bone morphogenetic protein-induced factor 1, Brain-specific protein 1, ZBT24_MOUSE, Zinc finger and BTB domain-containing protein 24, Zinc finger protein 450
Organisms: Mus musculus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q80X44
Length: 143
Pfam Domains: 5-15 C2H2-type zinc finger
5-27 Zinc finger, C2H2 type
5-27 C2H2-type zinc finger
34-55 C2H2-type zinc finger
34-55 C2H2-type zinc finger
34-54 Zinc-finger of C2H2 type
48-71 Zinc-finger double domain
60-84 C2H2-type zinc finger
61-83 Zinc-finger of C2H2 type
61-83 Zinc finger, C2H2 type
61-83 C2H2-type zinc finger
75-99 Zinc-finger double domain
89-100 C2H2-type zinc finger
89-111 Zinc finger, C2H2 type
89-111 C2H2-type zinc finger
105-127 Zinc-finger double domain
117-139 C2H2-type zinc finger
117-137 C2H2-type zinc finger
117-139 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 GSKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQLKKHLRTHTGEKP 60
61 FTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCP 120
121 ECGLQFARLDNLKAHLKIHSKEK
Interface Residues: 15, 16, 17, 18, 19, 22, 26, 43, 44, 45, 46, 47, 49, 50, 52, 53, 56, 61, 71, 72, 73, 74, 75, 77, 78, 82, 86, 99, 100, 101, 102, 103, 105, 106, 127, 128, 129, 130, 131, 133, 134, 137
3D-footprint Homologues: 5v3j_F, 8ssq_A, 7w1m_H, 8ssu_A, 1tf6_A, 8cuc_F, 7y3l_A, 7n5w_A, 8gn3_A, 2gli_A, 8h9h_G, 7ysf_A, 6e94_A, 7y3m_I, 2jpa_A, 1ubd_C, 2kmk_A, 1tf3_A, 6u9q_A, 2lt7_A, 1yuj_A, 7txc_E, 2drp_D
Binding Motifs: 6ml4_A CGTCCAGGACCTg
6ml6_A CGTCCAGGACCT
6ml7_A AGGTCCTGGAmGa
Binding Sites: 6ml4_E
6ml4_F
6ml6_F / 6ml7_F
6ml6_E
6ml7_E
Publications: Ren R, Hardikar S, Horton JR, Lu Y, Zeng Y, Singh AK, Lin K, Coletta LD, Shen J, Lin Kong CS, Hashimoto H, Zhang X, Chen T, Cheng X. Structural basis of specific DNA binding by the transcription factor ZBTB24. Nucleic Acids Res 47:8388-8398 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.