Transcription Factor
| Accessions: | ZNF345 (HT-SELEX2 May2017) |
| Names: | ENSG00000167637, ZNF345 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 447 |
| Pfam Domains: | 10-31 Zinc-finger double domain 21-41 C2H2-type zinc finger 22-43 Zinc finger, C2H2 type 36-59 Zinc-finger double domain 48-69 C2H2-type zinc finger 49-71 C2H2-type zinc finger 49-71 Zinc finger, C2H2 type 63-87 Zinc-finger double domain 76-97 C2H2-type zinc finger 77-99 C2H2-type zinc finger 77-99 Zinc finger, C2H2 type 91-115 Zinc-finger double domain 104-124 C2H2-type zinc finger 105-127 Zinc finger, C2H2 type 120-143 Zinc-finger double domain 132-151 C2H2-type zinc finger 133-153 C2H2-type zinc finger 133-155 Zinc finger, C2H2 type 148-171 Zinc-finger double domain 160-181 C2H2-type zinc finger 161-183 Zinc finger, C2H2 type 175-200 Zinc-finger double domain 188-209 C2H2-type zinc finger 189-211 Zinc finger, C2H2 type 189-211 C2H2-type zinc finger 203-227 Zinc-finger double domain 217-239 Zinc finger, C2H2 type 217-237 C2H2-type zinc finger 217-239 C2H2-type zinc finger 231-255 Zinc-finger double domain 245-267 Zinc finger, C2H2 type 245-265 C2H2-type zinc finger 245-267 C2H2-type zinc finger 259-283 Zinc-finger double domain 272-295 C2H2-type zinc finger 273-295 Zinc finger, C2H2 type 273-295 C2H2-type zinc finger 290-312 Zinc-finger double domain 300-319 C2H2-type zinc finger 301-321 C2H2-type zinc finger 301-323 Zinc finger, C2H2 type 315-339 Zinc-finger double domain 328-348 C2H2-type zinc finger 329-351 C2H2-type zinc finger 329-351 Zinc finger, C2H2 type 346-368 Zinc-finger double domain 356-377 C2H2-type zinc finger 357-379 C2H2-type zinc finger 357-379 Zinc finger, C2H2 type 371-395 Zinc-finger double domain 384-405 C2H2-type zinc finger 385-407 Zinc finger, C2H2 type 385-407 C2H2-type zinc finger 399-423 Zinc-finger double domain 412-436 C2H2-type zinc finger 413-435 Zinc finger, C2H2 type 413-436 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 PEDMPTFSIQHQRIHTDEKLLECKECGKDFSFVSVLVRHQRIHTGEKPYECKECGKAFGS 60 61 GANLAYHQRIHTGEKPFECKECGKAFGSGSNLTHHQRIHTGEKPYECKECGKAFSFGSGL 120 121 IRHQIIHSGEKPYECKECGKSFSFESALIRHHRIHTGEKPYECIDCGKAFGSGSNLTQHR 180 181 RIHTGEKPYECKACGMAFSSGSALTRHQRIHTGEKPYICNECGKAFSFGSALTRHQRIHT 240 241 GEKPYVCKECGKAFNSGSDLTQHQRIHTGEKPYECKECEKAFRSGSKLIQHQRMHTGEKP 300 301 YECKECGKTFSSGSDLTQHHRIHTGEKPYECKECGKAFGSGSKLIQHQLIHTGERPYECK 360 361 ECGKSFSSGSALNRHQRIHTGEKPYECKECGKAFYSGSSLTQHQRIHTGEKLYECKNCGK 420 421 AYGRDSEFQQHKKSHNGKKLCELETIN |
| Interface Residues: | 32, 34, 35, 38, 60, 62, 63, 66, 88, 89, 90, 91, 94, 116, 117, 118, 119, 122, 144, 145, 146, 147, 149, 150, 171, 172, 173, 174, 175, 178, 182, 199, 200, 201, 202, 203, 205, 206, 210, 228, 229, 230, 231, 233, 234, 235, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 268, 283, 284, 285, 286, 287, 289, 290, 311, 312, 313, 314, 315, 316, 318, 321, 329, 339, 340, 341, 342, 343, 346, 352, 366, 367, 368, 369, 370, 371, 373, 374, 378, 395, 396, 397, 398, 399, 401, 402, 406, 424, 425, 426, 427 |
| 3D-footprint Homologues: | 6wmi_A, 5kl3_A, 7y3m_I, 5yj3_D, 5v3j_F, 7ysf_A, 2drp_D, 7w1m_H, 5und_A, 2gli_A, 6jnm_A, 7n5w_A, 5kkq_D, 6u9q_A, 1mey_C, 8ssq_A, 1g2f_F, 8ssu_A, 6ml4_A, 4x9j_A, 8h9h_G, 6e94_A, 6a57_A, 2wbs_A, 1llm_D, 5yel_A, 5ei9_F, 7txc_E, 2i13_A, 4m9v_C, 1tf3_A, 6blw_A, 5k5i_A, 5k5l_F, 1tf6_A, 2jpa_A, 7eyi_G, 1ubd_C, 2kmk_A, 8gn3_A, 3uk3_C, 8cuc_F, 7y3l_A, 1f2i_J, 2lt7_A |
| Binding Motifs: | ZNF345_2 TTGCAACmyrrrCAACyGkaCc ZNF345_methyl_1 TyGCAACmyvwrCAACTGkaCc |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.