Transcription Factor

Accessions: DPRX_DBD (HumanTF 1.0), DPRX (HT-SELEX2 May2017)
Names: DPRX, DPRX_HUMAN, ENSG00000204595
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: A6NFQ7
Notes: Ensembl ID: ENSG00000204595; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 96
Pfam Domains: 17-72 Homeobox domain
Sequence:
(in bold interface residues)
1 PGSEDLRKGKDQMHSHRKRTMFTKKQLEDLNILFNENPYPNPSLQKEMASKIDIHPTVLQ 60
61 VWFKNHRAKLKKAKCKHIHQKQETPQPPIPEGGVST
Interface Residues: 16, 17, 18, 19, 57, 58, 60, 61, 64, 65, 67, 68, 69, 72
3D-footprint Homologues: 1puf_A, 8ejp_B, 6a8r_A, 3cmy_A, 3d1n_M, 5zfz_A, 1fjl_B, 2lkx_A, 1jgg_B, 1nk2_P, 1zq3_P, 6m3d_C, 3lnq_A, 2ld5_A, 9b8u_A, 1b72_A, 5zjt_E, 3a01_E, 2d5v_B, 8ik5_C, 1ig7_A, 7psx_B, 5hod_A, 3rkq_B, 2hdd_A, 8osb_E, 7q3o_C, 5jlw_D, 4cyc_A, 2r5y_A, 1puf_B, 8eml_B, 6es3_K, 4xrs_G, 2hos_A, 8pmf_A, 1au7_A, 4j19_B, 5flv_I, 1e3o_C, 7xrc_C, 2xsd_C, 1o4x_A, 8bx1_A, 4qtr_D, 1du0_A, 8g87_X, 4xrm_B
Binding Motifs: DPRX_DBD_1 rsgGATTAdc
DPRX_DBD_2 srGaTAATCys
DPRX_2 aGmTAATCys
DPRX_methyl_1 AGATaATCyy
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.