Transcription Factor
| Accessions: | 6edb_B (3D-footprint 20231221) |
| Names: | 2'3'-cGAMP synthase, cGAMP synthase, CGAS_HUMAN, EC 2.7.7.86, h-cGAS, Mab-21 domain-containing protein 1, Sex-determining region Y protein,Cyclic GMP-AMP synthase |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 67 |
| Pfam Domains: | 1-67 HMG (high mobility group) box 1-58 Domain of unknown function (DUF1898) |
| Sequence: (in bold interface residues) | 1 KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH 60 61 REKYPNY |
| Interface Residues: | 2, 5, 7, 8, 11, 15, 26, 27, 28, 31 |
| 3D-footprint Homologues: | 4s2q_D, 1qrv_A, 3tmm_A, 4y60_C, 2gzk_A, 1j5n_A, 6jrp_D, 2lef_A, 3u2b_C, 1o4x_B, 7m5w_A, 3f27_D, 1hry_A, 3tq6_B |
| Binding Motifs: | 6edb_AB cATTgkknnnnnCc 6edb_B AATg |
| Binding Sites: | 6edb_C 6edb_D |
| Publications: | Xie W, Lama L, Adura C, Tomita D, Glickman JF, Tuschl T, Patel DJ. Human cGAS catalytic domain has an additional DNA-binding interface that enhances enzymatic activity and liquid-phase condensation. Proc Natl Acad Sci U S A 116:11946-11955 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.