Transcription Factor

Accessions: ttk-PF (FlyZincFinger 1.0 )
Names: CG1856
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 228
Pfam Domains: 45-68 C2H2-type zinc finger
81-104 Zinc finger, C2H2 type
81-104 C2H2-type zinc finger
199-222 Zinc finger, C2H2 type
199-219 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KRPIQRRRVRRKAQSTLDDQAEHLTEMSVRGLDLFRYASVVEGVYRCTECAKENMQKTFK 60
61 NKYSFQRHAFLYHEGKHRKVFPCPVCSKEFSRPDKMKNHLKMTHENFTPPKDIGAFSPLK 120
121 YLISAAAAGDMHATTPSVKTKLNLSSNVGEGEAEGSVRDYCTKEGEHTYRCKVCSRVYTH 180
181 ISNFCRHYVTSHKRNVKVYPCPFCFKEFTRKDNMTAHVKIIHKIENPS
Interface Residues: 60, 61, 62, 63, 64, 67, 91, 92, 93, 94, 95, 97, 98, 102, 118, 119, 121, 124, 128, 136, 138, 139, 140, 141, 142, 144, 157, 158, 159, 164, 169, 179, 180, 181, 182, 183, 185, 186, 209, 210, 211, 212, 213, 216, 219
3D-footprint Homologues: 7y3l_A, 1ubd_C, 8gn3_A, 2gli_A, 7w1m_H, 5v3j_F, 1tf6_A, 8ssq_A, 8ssu_A, 7ysf_A, 2kmk_A, 7n5w_A, 2jpa_A, 6e94_A, 8cuc_F, 6u9q_A, 2drp_D, 8h9h_G, 7y3m_I, 2lt7_A, 7txc_E
Binding Motifs: ttk-PA_SANGER_5_FBgn0003870 CmaCCCYTA
ttk-PA_SOLEXA_FBgn0003870 mmamCmACCCCyamm
ttk-PF_SANGER_5_FBgn0003870 MAGGAYA
ttk-PF_SOLEXA_FBgn0003870 MAGGAyAhcmm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.