Transcription Factor

Accessions: 6cij_N (3D-footprint 20241219)
Names: High mobility group protein 1, High mobility group protein B1, HMG-1, HMGB1_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 133
Pfam Domains: 1-62 Domain of unknown function (DUF1898)
5-67 HMG (high mobility group) box
69-133 Domain of unknown function (DUF1898)
72-133 HMG (high mobility group) box
Sequence:
(in bold interface residues)
1 PRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKKEKGKFEDMAKADKARYE 60
61 REKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAAKQPYE 120
121 KKAAKLKEKYEKD
Interface Residues: 5, 8, 10, 11, 18, 30, 34, 61, 64, 74, 77, 79, 80, 83, 87, 98, 99, 100, 103
3D-footprint Homologues: 2gzk_A, 2lef_A, 7m5w_A
Binding Motifs: 6cij_CN ACnnnnnnnnnnnnnAAGTnnnnAnnnAG
Binding Sites: 6cij_G
6cij_M
Publications: Kim MS, Chuenchor W, Chen X, Cui Y, Zhang X, Zhou ZH, Gellert M, Yang W. Cracking the DNA Code for V(D)J Recombination. Mol Cell 70:358-370 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.