Transcription Factor
Accessions: | GFI1B_MOUSE (HOCOMOCO 10), O70237 (JASPAR 2024) |
Names: | GFI1B_MOUSE, Growth factor independent protein 1B, Zinc finger protein Gfi-1b |
Organisms: | Mus musculus |
Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Length: | 330 |
Pfam Domains: | 163-186 Zinc finger, C2H2 type 163-186 C2H2-type zinc finger 178-203 Zinc-finger double domain 192-214 Zinc finger, C2H2 type 192-211 C2H2-type zinc finger 192-214 C2H2-type zinc finger 192-210 Zinc-finger of C2H2 type 206-231 Zinc-finger double domain 220-242 Zinc finger, C2H2 type 220-238 C2H2-type zinc finger 220-242 C2H2-type zinc finger 235-258 Zinc-finger double domain 248-270 Zinc finger, C2H2 type 248-257 C2H2-type zinc finger 248-266 C2H2-type zinc finger 263-286 Zinc-finger double domain 275-298 C2H2-type zinc finger 276-298 C2H2-type zinc finger 276-298 Zinc finger, C2H2 type 290-313 Zinc-finger double domain 304-327 C2H2-type zinc finger 304-327 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 MPRSFLVKSKKAHTYHQPRAQGDELVWPPAVIPVAKEHSQSASPLLSTPLPSQTLDWNTI 60 61 KQEREMLLNQSLPKMASAPEGPLVTPQPQDGESPLSESPPFYKPSFSWDTLASSYSHSYT 120 121 QTPSTMQSAFLERSVRLYGSPLVPSTESPLDFRLRYSPGMDTYHCVKCNKVFSTPHGLEV 180 181 HVRRSHSGTRPFACDVCGKTFGHAVSLEQHTHVHSQERSFECRMCGKAFKRSSTLSTHLL 240 241 IHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTG 300 301 FKPFSCELCTKGFQRKVDLRRHRESQHNLK |
Interface Residues: | 147, 148, 174, 176, 177, 180, 200, 202, 203, 204, 205, 206, 208, 209, 210, 213, 220, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 243, 258, 259, 260, 261, 262, 264, 265, 268, 286, 287, 288, 289, 290, 292, 293, 314, 315, 316, 317, 318, 319, 320, 321, 325 |
3D-footprint Homologues: | 5v3j_F, 6wmi_A, 5und_A, 5k5l_F, 8ssq_A, 1tf6_A, 8ssu_A, 8gh6_A, 7y3m_I, 5kkq_D, 6jnm_A, 5k5i_A, 7w1m_H, 4m9v_C, 7ysf_A, 2lt7_A, 2i13_A, 6a57_A, 5yel_A, 1ubd_C, 2kmk_A, 7n5w_A, 2drp_D, 6ml4_A, 5ei9_F, 8gn3_A, 8h9h_G, 7eyi_G, 6e94_A, 2jpa_A, 1tf3_A, 1f2i_J, 2gli_A, 1g2f_F, 4x9j_A, 6blw_A, 2wbs_A, 6u9q_A, 1mey_C, 7txc_E, 5kl3_A, 8cuc_F, 7y3l_A, 3uk3_C, 1llm_D, 5yj3_D |
Binding Motifs: | MA0483.1 aAATCwCwGCw GFI1B_MOUSE.H10MO.C|M01126 GCwswGATTts MA0483.2 aAATCwCwGC |
Binding Sites: | MA0483.1.1 MA0483.1.10 MA0483.1.11 MA0483.1.12 MA0483.1.13 MA0483.1.14 MA0483.1.15 MA0483.1.16 MA0483.1.17 MA0483.1.18 MA0483.1.19 MA0483.1.2 MA0483.1.20 MA0483.1.3 MA0483.1.4 MA0483.1.5 MA0483.1.6 MA0483.1.7 MA0483.1.8 MA0483.1.9 MA0483.2.1 MA0483.2.10 MA0483.2.11 MA0483.2.12 MA0483.2.13 MA0483.2.14 MA0483.2.15 MA0483.2.16 MA0483.2.17 MA0483.2.18 MA0483.2.19 MA0483.2.2 MA0483.2.20 MA0483.2.3 MA0483.2.4 MA0483.2.5 MA0483.2.6 MA0483.2.7 MA0483.2.8 MA0483.2.9 |
Publications: | Anguita E, Villegas A, Iborra F, Hernández A. GFI1B controls its own expression binding to multiple sites. Haematologica 95:36-46 (2010). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.