Transcription Factor
| Accessions: | shn-F1-2 (FlyZincFinger 1.0 ) |
| Names: | CG7734 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 59 |
| Pfam Domains: | 2-24 Zinc finger, C2H2 type 2-24 C2H2-type zinc finger 17-41 Zinc-finger double domain 30-54 Zinc finger, C2H2 type 30-51 C2H2-type zinc finger 32-54 Zinc-finger of C2H2 type |
| Sequence: (in bold interface residues) | 1 RYVCQYCNLICAKPSVLEKHIRAHTNERPYPCDTCGIAFKTKSNLYKHCRSRSHAARAR |
| Interface Residues: | 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 25, 40, 41, 42, 43, 44, 45, 46, 47, 48 |
| 3D-footprint Homologues: | 2kmk_A, 8cuc_F, 7y3l_A, 1tf3_A, 1g2f_F, 3uk3_C, 5k5i_A, 8ssq_A, 7w1m_H, 1mey_C, 5und_A, 1f2i_J, 5k5l_F, 2lt7_A, 8ssu_A, 6ml4_A, 5v3j_F, 4x9j_A, 8gn3_A, 2i13_A, 7n5w_A, 6blw_A, 5kkq_D, 1tf6_A, 6u9q_A, 5ei9_F, 8h9h_G, 1llm_D, 5kl3_A, 1ubd_C, 6wmi_A, 4m9v_C, 7eyi_G, 7y3m_I, 6e94_A, 7ysf_A, 2jpa_A, 6jnm_A, 6a57_A, 2wbs_A, 5yel_A, 7txc_E, 5yj3_D, 2gli_A |
| Binding Motifs: | shn-F1-2_SANGER_5_FBgn0003396 kGGAATyCCCT shn-F1-2_SOLEXA_FBgn0003396 GGGGATTCCckkkgg |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.