Transcription Factor
| Accessions: | T028109_1.02 (CISBP 1.02), UP00454A (UniPROBE 20160601), P40917 (JASPAR 2024) |
| Names: | CIN5, T028109_1.02;, Chromosome INstability, HAL6, AP-1-like transcription factor YAP4, Chromosome instability protein 5, Transcription activator CIN5, YAP4_YEAST |
| Organisms: | Saccharomyces cerevisiae |
| Libraries: | CISBP 1.02 1, UniPROBE 20160601 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Hume MA, Barrera LA, Gisselbrecht SS, Bulyk ML. UniPROBE, update 2015: new tools and content for the online database of protein-binding microarray data on protein-DNA interactions. Nucleic Acids Res : (2015). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Description: | Chromosome INstability : Basic leucine zipper (bZIP) transcription factor of the yAP-1 family; physically interacts with the Tup1-Cyc8 complex and recruits Tup1p to its targets; mediates pleiotropic drug resistance and salt tolerance; nuclearly localized under oxidative stress and sequestered in the cytoplasm by Lot6p under reducing conditions |
| Notes: | experiment type:PBM, family:bZIP |
| Length: | 295 |
| Pfam Domains: | 236-293 bZIP transcription factor |
| Sequence: (in bold interface residues) | 1 MLMQIKMDNHPFNFQPILASHSMTRDSTKPKKMTDTAFVPSPPVGFIKEENKADLHTISV 60 61 VASNVTLPQIQLPKIATLEEPGYESRTGSLTDLSGRRNSVNIGALCEDVPNTAGPHIARP 120 121 VTINNLIPPSLPRLNTYQLRPQLSDTHLNCHFNSNPYTTASHAPFESSYTTASTFTSQPA 180 181 ASYFPSNSTPATRKNSATTNLPSEERRRVSVSLSEQVFNEGERYNNDGQLIGKTGKPLRN 240 241 TKRAAQNRSAQKAFRQRREKYIKNLEEKSKLFDGLMKENSELKKMIESLKSKLKE |
| Interface Residues: | 243, 246, 247, 248, 250, 251, 254, 255 |
| 3D-footprint Homologues: | 1gd2_G |
| Binding Motifs: | M0357_1.02 gmTTAcrTaA UP00454A_1 whkktgmTTACGTAAkmycswk MA0284.1 TtAygTAAkC MA0284.2 wrATTACrTAATcw MA0284.3 ATTACrTAAT |
| Binding Sites: | TGACGTAA TGACGTCA CGTAATCA ACGTAATA ACGTAATC ATTACGTA CGTAAGCA CTTACGTA TGACATAA TTACATAA TTACCTAA TTACGTAA TTATATAA ACATAAGC ACATAATC ACGTAAGC ATGTAAGC ATTACGTG GATTACGA TTAAGTAA MA0284.2.1 MA0284.2.10 / MA0284.2.11 MA0284.2.11 / MA0284.2.12 MA0284.2.12 / MA0284.2.13 / MA0284.2.15 / MA0284.2.19 MA0284.2.13 / MA0284.2.15 / MA0284.2.16 / MA0284.2.19 MA0284.2.14 / MA0284.2.17 / MA0284.2.20 / MA0284.2.8 / MA0284.2.9 MA0284.2.17 MA0284.2.18 MA0284.2.2 MA0284.2.3 MA0284.2.4 MA0284.2.5 / MA0284.2.6 MA0284.2.10 / MA0284.2.6 / MA0284.2.7 / MA0284.2.9 MA0284.2.7 MA0284.2.14 / MA0284.2.20 MA0284.2.16 MA0284.2.18 / MA0284.2.8 MA0284.2.5 MA0284.3.1 MA0284.3.10 / MA0284.3.11 MA0284.3.12 / MA0284.3.15 MA0284.3.13 / MA0284.3.14 / MA0284.3.16 / MA0284.3.19 / MA0284.3.20 / MA0284.3.8 MA0284.3.17 MA0284.3.18 MA0284.3.2 MA0284.3.3 MA0284.3.4 MA0284.3.5 MA0284.3.6 / MA0284.3.9 MA0284.3.7 |
| Publications: | Gordân R, Murphy KF, McCord RP, Zhu C, Vedenko A, Bulyk ML. Curated collection of yeast transcription factor DNA binding specificity data reveals novel structural and gene regulatory insights. Genome Biol : (2011). [Pubmed] Badis G, Chan E.T, van Bakel H, Pena-Castillo L, Tillo D, Tsui K, Carlson C.D, Gossett A.J, Hasinoff M.J, Warren C.L, Gebbia M, Talukder S, Yang A, Mnaimneh S, Terterov D, Coburn D, Li Yeo A, Yeo Z.X, Clarke N.D, Lieb J.D, Ansari A.Z, Nislow C, Hughes T.R. A library of yeast transcription factor motifs reveals a widespread function for Rsc3 in targeting nucleosome exclusion at promoters. Molecular cell 32:878-87 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.