Transcription Factor
| Accessions: | 1ysa_D (3D-footprint 20260701) |
| Names: | Amino acid biosynthesis regulatory protein, GCN4_YEAST, General control protein GCN4 |
| Organisms: | Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P03069 |
| Length: | 57 |
| Pfam Domains: | 3-55 bZIP transcription factor 3-53 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MKDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGE |
| Interface Residues: | 8, 9, 11, 12, 13, 14, 15, 16, 19, 20 |
| 3D-footprint Homologues: | 7x5e_F, 8k86_A, 8k8c_A, 6mg1_B, 1llm_D, 5t01_B, 5vpe_D, 2dgc_A |
| Binding Motifs: | 1ysa_CD TGAGTCA 1ysa_D TgAC |
| Binding Sites: | 1ysa_A 1ysa_B |
| Publications: | Ellenberger T., Brandl C. J., Struhl K., Harrison S. C. The GCN4 basic region leucine zipper binds DNA as a dimer of uninterrupted helices: Crystal structure of the protein-DNA complex. Cell 71:1223-1237 (1992). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.