Transcription Factor
| Accessions: | 2prt_A (3D-footprint 20260701) |
| Names: | Wilms tumor 1, Wilms tumor protein, WT1_HUMAN, WT33 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P19544 |
| Length: | 115 |
| Pfam Domains: | 5-27 C2H2-type zinc finger 19-46 Zinc-finger double domain 33-57 Zinc finger, C2H2 type 33-57 C2H2-type zinc finger 50-74 Zinc-finger double domain 63-85 Zinc finger, C2H2 type 63-85 C2H2-type zinc finger 63-83 Zinc-finger of C2H2 type 77-103 Zinc-finger double domain 91-115 Zinc finger, C2H2 type 91-111 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV 60 61 KPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH |
| Interface Residues: | 15, 16, 17, 18, 19, 21, 22, 24, 25, 28, 45, 46, 47, 48, 49, 51, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 103, 104, 105, 106, 107, 109, 110 |
| 3D-footprint Homologues: | 6jnm_A, 3uk3_C, 7n5w_A, 5ei9_F, 6ml4_A, 5v3j_F, 8ssq_A, 7w1m_H, 6blw_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 2gli_A, 8h9h_G, 7y3m_I, 1tf6_A, 7ysf_A, 6e94_A, 2lt7_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 1tf3_A, 4x9j_A, 1f2i_J, 5kl3_A, 2wbs_A, 7txc_E, 1g2f_F, 5k5i_A, 5yel_A, 2drp_D, 4m9v_C, 6a57_A, 8gn3_A, 5yj3_D, 1llm_D |
| Binding Motifs: | 2prt_A rCGCCCcCgC |
| Binding Sites: | 2prt_B 2prt_C |
| Publications: | Stoll R, Lee B.M, Debler E.W, Laity J.H, Wilson I.A, Dyson H.J, Wright P.E. Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA. Journal of molecular biology 372:1227-45 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.