Transcription Factor
| Accessions: | 6m3d_C (3D-footprint 20250804) |
| Names: | HMEN_DROME, Segmentation polarity homeobox protein engrailed,Segmentation polarity homeobox protein engrailed |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P02836 |
| Length: | 108 |
| Pfam Domains: | 1-52 Homeobox domain 51-106 Homeobox domain |
| Sequence: (in bold interface residues) | 1 RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKAARPRTAFSSEQ 60 61 LARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKAAKIKKSG |
| Interface Residues: | 1, 43, 46, 47, 50, 51, 52, 53, 91, 92, 94, 95, 98, 99, 101, 102, 103, 106 |
| 3D-footprint Homologues: | 6es3_K, 8ejp_B, 5zfz_A, 4j19_B, 6a8r_A, 1le8_B, 8pmf_A, 1zq3_P, 1nk2_P, 2lkx_A, 1puf_A, 6m3d_C, 1jgg_B, 3lnq_A, 3a01_E, 9b8u_A, 1fjl_B, 7q3o_C, 5jlw_D, 3rkq_B, 2ld5_A, 8ik5_C, 1b72_A, 4xrs_G, 3cmy_A, 2d5v_B, 1ig7_A, 4cyc_A, 8osb_E, 5flv_I, 3d1n_M, 2hdd_A, 8eml_B, 5zjt_E, 2r5y_A, 7psx_B, 5hod_A, 2hos_A, 1au7_A, 1e3o_C, 4qtr_D, 1du0_A, 1puf_B, 8g87_X |
| Binding Motifs: | 6m3d_C CyAATCc |
| Binding Sites: | 6m3d_A 6m3d_B |
| Publications: | Sunami T, Hirano Y, Tamada T, Kono H. Structural basis for designing an array of engrailed homeodomains. Acta Crystallogr D Struct Biol : (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.