Transcription Factor

						

			
Accessions: 6m3d_C (3D-footprint 20231221)

			
Names: HMEN_DROME, Segmentation polarity homeobox protein engrailed,Segmentation polarity homeobox protein engrailed
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P02836
Length: 108
Pfam Domains:      1-52 Homeobox domain
   51-106 Homeobox domain
Sequence: 
(in bold interface residues)		   1 RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKAARPRTAFSSEQ   60
  61 LARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKAAKIKKSG
Interface Residues: 1, 43, 46, 47, 50, 51, 52, 53, 54, 91, 92, 94, 95, 98, 99, 102, 103, 106
3D-footprint Homologues: 5zfz_A, 4j19_B, 6a8r_A, 6es3_K, 1o4x_A, 1le8_B, 2lkx_A, 6m3d_C, 1nk2_P, 1zq3_P, 1jgg_B, 3lnq_A, 1puf_A, 1b72_A, 4cyc_A, 1ig7_A, 5flv_I, 3d1n_M, 2hdd_A, 5zjt_E, 2r5y_A, 7psx_B, 5hod_A, 2hos_A, 3a01_E, 2d5v_B, 7q3o_C, 1au7_A, 5jlw_D, 3rkq_B, 2ld5_A, 1fjl_B, 4xrs_G, 3cmy_A, 2h1k_B, 1mnm_C, 1e3o_C, 1puf_B, 1du0_A, 4qtr_D, 8g87_X
Binding Motifs: 6m3d_C CyAATCc
Binding Sites: 6m3d_A
6m3d_B
			
Publications: Sunami T, Hirano Y, Tamada T, Kono H. Structural basis for designing an array of engrailed homeodomains. Acta Crystallogr D Struct Biol : (2020). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.