Transcription Factor

Accessions: 2fio_B (3D-footprint 20241219)
Names: Gene product 4, gp4, Late genes activator, Late genes activator p4, Protein p4, TF4_BPPH2
Organisms: Bacillus phage phi29
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03682
Length: 113
Pfam Domains: 1-113 Phi-29-like late genes activator (early protein GP4)
Sequence:
(in bold interface residues)
1 PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWN 60
61 MDMLADITFYSEVEKRGFHAWLKGDNATWREVHVYALRIMTKPNTLDWSRIQK
Interface Residues: 2, 4, 5, 75
3D-footprint Homologues: 4esv_L, 2fio_A, 8x5v_A
Binding Motifs: 2fio_AB AaCtnnnnnnnnnnnnnnnnnnnnnnnTGTT
Binding Sites: 2fio_C
2fio_D
Publications: Badia D, Camacho A, Pérez-Lago L, Escandón C, Salas M, Coll M. The structure of phage phi29 transcription regulator p4-DNA complex reveals an N-hook motif for DNA. Molecular cell 22:73-81 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.