Transcription Factor
Accessions: | 2fio_B (3D-footprint 20231221) |
Names: | Gene product 4, gp4, Late genes activator, Late genes activator p4, Protein p4, TF4_BPPH2 |
Organisms: | Bacillus phage phi29 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P03682 |
Length: | 113 |
Pfam Domains: | 1-113 Phi-29-like late genes activator (early protein GP4) |
Sequence: (in bold interface residues) | 1 PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWN 60 61 MDMLADITFYSEVEKRGFHAWLKGDNATWREVHVYALRIMTKPNTLDWSRIQK |
Interface Residues: | 2, 4, 5 |
3D-footprint Homologues: | 4esv_L, 2fio_A |
Binding Motifs: | 2fio_AB AaCtnnnnnnnnnnnnnnnnnnnnnnnTGTT |
Binding Sites: | 2fio_C 2fio_D |
Publications: | Badia D, Camacho A, Pérez-Lago L, Escandón C, Salas M, Coll M. The structure of phage phi29 transcription regulator p4-DNA complex reveals an N-hook motif for DNA. Molecular cell 22:73-81 (2006). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.