Transcription Factor
| Accessions: | T095241_1.02 (CISBP 1.02), Q810N8 (JASPAR 2024) |
| Names: | Rhox11, T095241_1.02;, Q810N8_MOUSE, Reproductive homeobox 11, Reproductive homeobox on X chromosome 11 |
| Organisms: | Mus musculus |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q810N8 |
| Notes: | experiment type:PBM, family:Homeodomain |
| Length: | 206 |
| Pfam Domains: | 94-147 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MSRKYFYFDYDYYGMSFCEEEITTEPEEKVAYTSNSGGFADEVTGIPKEGHQSSIGEHSC 60 61 VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWELQAVFVENQYPDALKR 120 121 KELAGLLNVDEQKIKDWFNNKRAKYRKIQREILGGKNITPTQEELRMKTLVESKKIIIFQ 180 181 EQEGDGLFWEHQNIDTQNSPLSLLFS |
| Interface Residues: | 89, 92, 93, 94, 95, 96, 132, 133, 135, 136, 139, 140, 142, 143, 144, 147, 156 |
| 3D-footprint Homologues: | 7psx_B, 2ld5_A, 2d5v_B, 8pmf_A, 2lkx_A, 4xrs_G, 2r5y_A, 6m3d_C, 4j19_B, 1zq3_P, 1mnm_C, 5zfz_A, 8ik5_C, 8ejp_B, 6a8r_A, 1le8_B, 1k61_B, 5jlw_D, 7q3o_C, 7xrc_C, 1e3o_C, 1au7_A, 2xsd_C, 8osb_E, 1le8_A, 1ig7_A, 3a01_E, 1du0_A, 3rkq_B, 1puf_A, 8eml_B, 1jgg_B, 6es3_K, 3cmy_A, 2hdd_A, 9b8u_A, 4cyc_A, 1puf_B, 5flv_I, 3d1n_M, 1nk2_P, 8bx1_A, 1fjl_B, 5zjt_E, 1b72_A, 5hod_A, 3lnq_A, 1o4x_A, 4qtr_D, 2hos_A |
| Binding Motifs: | MA0629.1 / PH0157.1 amkmyGCTGTwAwrsrw PH0158.1 arkmcGCTGTwAwgsrw M1046_1.02 wwwwACAbcr MA0629.2 yGCTGTwAw |
| Publications: | Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.