Transcription Factor

Accessions: 1tro_G (3D-footprint 20241219)
Names: TRP REPRESSOR, TRPR_ECOLI
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0A881
Length: 101
Pfam Domains: 13-99 Trp repressor protein
Sequence: SPYSAAMAEERHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEELLRG
EMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLL
Binding Motifs: 1tro_AG gtACTGTaC
Binding Sites: 1tro_I
1tro_J
Publications: Otwinowski Z., Schevitz RW., Zhang RG., Lawson CL., Joachimiak A., Marmorstein RQ., Luisi BF., Sigler PB. Crystal structure of trp repressor/operator complex at atomic resolution. Nature. 335(6188):321-9 (1988). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.