Transcription Factor

Accessions: BACH1_TF2 (HumanTF2 1.0)
Names: BACH1, BACH1_HUMAN, BTB and CNC homolog 1, HA2303, Transcription regulator protein BACH1
Organisms: Homo sapiens
Libraries: HumanTF2 1.0 1
1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: O14867
Notes: Ensembl ID: ENSG00000156273; Construct type: TF2(3xFLAG); TF family: bZIP; Clone source: MGC
Length: 144
Pfam Domains: 38-119 bZIP Maf transcription factor
70-118 bZIP transcription factor
71-111 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 CPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRNDFQSLLKMHKLT 60
61 PEQLDCIHDIRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLLKERDHILSTLG 120
121 ETKQNLTGLCQKVCKEAALSQEQI
Interface Residues: 72, 75, 76, 77, 79, 80, 83, 84, 87
3D-footprint Homologues: 4eot_A, 7x5e_F, 1skn_P, 2wt7_A, 2wt7_B, 7x5e_E, 1gd2_G, 5t01_B, 5vpe_D
Binding Motifs: BACH1 ATGACTCAt
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.