Transcription Factor
Accessions: | BACH1_TF2 (HumanTF2 1.0) |
Names: | BACH1, BACH1_HUMAN, BTB and CNC homolog 1, HA2303, Transcription regulator protein BACH1 |
Organisms: | Homo sapiens |
Libraries: | HumanTF2 1.0 1 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Uniprot: | O14867 |
Notes: | Ensembl ID: ENSG00000156273; Construct type: TF2(3xFLAG); TF family: bZIP; Clone source: MGC |
Length: | 144 |
Pfam Domains: | 38-119 bZIP Maf transcription factor 70-118 bZIP transcription factor 71-111 Basic region leucine zipper |
Sequence: (in bold interface residues) | 1 CPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRNDFQSLLKMHKLT 60 61 PEQLDCIHDIRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLLKERDHILSTLG 120 121 ETKQNLTGLCQKVCKEAALSQEQI |
Interface Residues: | 72, 75, 76, 77, 79, 80, 83, 84, 87 |
3D-footprint Homologues: | 4eot_A, 7x5e_F, 1skn_P, 2wt7_A, 2wt7_B, 7x5e_E, 1gd2_G, 5t01_B, 5vpe_D |
Binding Motifs: | BACH1 ATGACTCAt |
Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.